Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P10745 Retinol-binding protein 3 n=305 Tax=cellular organisms TaxID=131567 RepID=RET3_HUMAN MMREWVLLMSVLLCGLAGPTHLFQPSLVLDMAKVLLDNYCFPENLLGMQEAIQQAIKSHE ILSISDPQTLASVLTAGVQSSLNDPRLVISYEPSTPEPPPQVPALTSLSEEELLAWLQRG LRHEVLEGNVGYLRVDSVPGQEVLSMMGEFLVAHVWGNLMGTSALVLDLRHCTGGQVSGI PYIISYLHPGNTILHVDTIYNRPSNTTTEIWTLPQVLGERYGADKDVVVLTSSQTRGVAE DIAHILKQMRRAIVVGERTGGGALDLRKLRIGESDFFFTVPVSRSLGPLGGGSQTWEGSG VLPCVGTPAEQALEKALAILTLRSALPGVVHCLQEVLKDYYTLVDRVPTLLQHLASMDFS TVVSEEDLVTKLNAGLQAASEDPRLLVRAIGPTETPSWPAPDAAAEDSPGVAPELPEDEA IRQALVDSVFQVSVLPGNVGYLRFDSFADASVLGVLAPYVLRQVWEPLQDTEHLIMDLRH NPGGPSSAVPLLLSYFQGPEAGPVHLFTTYDRRTNITQEHFSHMELPGPRYSTQRGVYLL TSHRTATAAEEFAFLMQSLGWATLVGEITAGNLLHTRTVPLLDTPEGSLALTVPVLTFID NHGEAWLGGGVVPDAIVLAEEALDKAQEVLEFHQSLGALVEGTGHLLEAHYARPEVVGQT SALLRAKLAQGAYRTAVDLESLASQLTADLQEVSGDHRLLVFHSPGELVVEEAPPPPPAV PSPEELTYLIEALFKTEVLPGQLGYLRFDAMAELETVKAVGPQLVRLVWQQLVDTAALVI DLRYNPGSYSTAIPLLCSYFFEAEPRQHLYSVFDRATSKVTEVWTLPQVAGQRYGSHKDL YILMSHTSGSAAEAFAHTMQDLQRATVIGEPTAGGALSVGIYQVGSSPLYASMPTQMAMS ATTGKAWDLAGVEPDITVPMSEALSIAQDIVALRAKVPTVLQTAGKLVADNYASAELGAK MATKLSGLQSRYSRVTSEVALAEILGADLQMLSGDPHLKAAHIPENAKDRIPGIVPMQIP SPEVFEELIKFSFHTNVLEDNIGYLRFDMFGDGELLTQVSRLLVEHIWKKIMHTDAMIID MRFNIGGPTSSIPILCSYFFDEGPPVLLDKIYSRPDDSVSELWTHAQVVGERYGSKKSMV ILTSSVTAGTAEEFTYIMKRLGRALVIGEVTSGGCQPPQTYHVDDTNLYLTIPTARSVGA SDGSSWEGVGVTPHVVVPAEEALARAKEMLQHNQLRVKRSPGLQDHL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 305  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P10745RET3_HUMANRetinol-binding protein 3Homo sapiens (Human)9606UniRef100_P10745
UniRef90_P10745
1,247Representative
P12666RET3_CAVPORetinol-binding protein 3 (Fragment)Cavia porcellus (Guinea pig)10141UniRef100_P12666
UniRef90_P10745
19
P49194RET3_MOUSERetinol-binding protein 3Mus musculus (Mouse)10090UniRef100_P49194
UniRef90_P49194
1,234
A0A2K6KB70A0A2K6KB70_RHIBERetinol binding protein 3Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6KB70
UniRef90_P10745
1,247
A0A2K6DH76A0A2K6DH76_MACNERetinol binding protein 3Macaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6DH76
UniRef90_P10745
1,247
F7HMX2F7HMX2_MACMURetinol binding protein 3Macaca mulatta (Rhesus macaque)9544UniRef100_F7HMX2
UniRef90_P10745
1,247
H2NAA2H2NAA2_PONABRBP3 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NAA2
UniRef90_P10745
1,247
K9NX42K9NX42_PONPYInterphotoreceptor retinoid binding protein (Fragment)Pongo pygmaeus (Bornean orangutan)9600UniRef100_H2NAA2
UniRef90_P10745
425
H2Q1V4H2Q1V4_PANTRRBP3 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_H2Q1V4
UniRef90_P10745
1,247
G7N1Z1G7N1Z1_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_G7N1Z1
UniRef90_P10745
1,247
A0A096P4C1A0A096P4C1_PAPANRetinol binding protein 3Papio anubis (Olive baboon)9555UniRef100_A0A096P4C1
UniRef90_P10745
1,247
G1RZS5G1RZS5_NOMLERetinol binding protein 3Nomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1RZS5
UniRef90_P10745
1,247
A0A2K5WPF5A0A2K5WPF5_MACFARetinol binding protein 3Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5WPF5
UniRef90_P10745
1,247
A0A2K5ZAW9A0A2K5ZAW9_MANLERetinol binding protein 3Mandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5ZAW9
UniRef90_P10745
1,247
A0A2K5MRV6A0A2K5MRV6_CERATRetinol binding protein 3Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5MRV6
UniRef90_P10745
1,247
K9NUR7K9NUR7_CERCHInterphotoreceptor retinoid binding protein (Fragment)Cercocebus chrysogaster (Golden-bellied mangabey) (Cercocebus galeritus chrysogaster)75569UniRef100_A0A2K5MRV6
UniRef90_P10745
426
G7PEU9G7PEU9_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7PEU9
UniRef90_P10745
1,247
G3QDF0G3QDF0_GORGORetinol binding protein 3Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QDF0
UniRef90_P10745
1,247
A0A2K5MRR7A0A2K5MRR7_CERATRetinol binding protein 3Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5MRR7
UniRef90_P10745
1,247
A0A2K6PIK8A0A2K6PIK8_RHIRORetinol binding protein 3Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PIK8
UniRef90_P10745
1,247
A0A0D9RCA1A0A0D9RCA1_CHLSBRetinol binding protein 3Chlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RCA1
UniRef90_P10745
1,247
A0A2R8ZEW4A0A2R8ZEW4_PANPARetinol binding protein 3Pan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R8ZEW4
UniRef90_P10745
1,247
A0A2K5IJG8A0A2K5IJG8_COLAPRetinol binding protein 3Colobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5IJG8
UniRef90_P10745
1,247
K9NX19K9NX19_COLANInterphotoreceptor retinoid binding protein (Fragment)Colobus angolensis (Angolan colobus)54131UniRef100_A0A2K5IJG8
UniRef90_P10745
426
A0A2K5ESY0A0A2K5ESY0_AOTNARetinol binding protein 3Aotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5ESY0
UniRef90_P10745
1,245

Sequence

Representative sequenceiLengthMass (Da)Tools
P10745

Checksumi: 6C1841411E012E0F

FASTA1,247135,362
        10         20         30         40         50
MMREWVLLMS VLLCGLAGPT HLFQPSLVLD MAKVLLDNYC FPENLLGMQE
60 70 80 90 100
AIQQAIKSHE ILSISDPQTL ASVLTAGVQS SLNDPRLVIS YEPSTPEPPP
110 120 130 140 150
QVPALTSLSE EELLAWLQRG LRHEVLEGNV GYLRVDSVPG QEVLSMMGEF
160 170 180 190 200
LVAHVWGNLM GTSALVLDLR HCTGGQVSGI PYIISYLHPG NTILHVDTIY
210 220 230 240 250
NRPSNTTTEI WTLPQVLGER YGADKDVVVL TSSQTRGVAE DIAHILKQMR
260 270 280 290 300
RAIVVGERTG GGALDLRKLR IGESDFFFTV PVSRSLGPLG GGSQTWEGSG
310 320 330 340 350
VLPCVGTPAE QALEKALAIL TLRSALPGVV HCLQEVLKDY YTLVDRVPTL
360 370 380 390 400
LQHLASMDFS TVVSEEDLVT KLNAGLQAAS EDPRLLVRAI GPTETPSWPA
410 420 430 440 450
PDAAAEDSPG VAPELPEDEA IRQALVDSVF QVSVLPGNVG YLRFDSFADA
460 470 480 490 500
SVLGVLAPYV LRQVWEPLQD TEHLIMDLRH NPGGPSSAVP LLLSYFQGPE
510 520 530 540 550
AGPVHLFTTY DRRTNITQEH FSHMELPGPR YSTQRGVYLL TSHRTATAAE
560 570 580 590 600
EFAFLMQSLG WATLVGEITA GNLLHTRTVP LLDTPEGSLA LTVPVLTFID
610 620 630 640 650
NHGEAWLGGG VVPDAIVLAE EALDKAQEVL EFHQSLGALV EGTGHLLEAH
660 670 680 690 700
YARPEVVGQT SALLRAKLAQ GAYRTAVDLE SLASQLTADL QEVSGDHRLL
710 720 730 740 750
VFHSPGELVV EEAPPPPPAV PSPEELTYLI EALFKTEVLP GQLGYLRFDA
760 770 780 790 800
MAELETVKAV GPQLVRLVWQ QLVDTAALVI DLRYNPGSYS TAIPLLCSYF
810 820 830 840 850
FEAEPRQHLY SVFDRATSKV TEVWTLPQVA GQRYGSHKDL YILMSHTSGS
860 870 880 890 900
AAEAFAHTMQ DLQRATVIGE PTAGGALSVG IYQVGSSPLY ASMPTQMAMS
910 920 930 940 950
ATTGKAWDLA GVEPDITVPM SEALSIAQDI VALRAKVPTV LQTAGKLVAD
960 970 980 990 1000
NYASAELGAK MATKLSGLQS RYSRVTSEVA LAEILGADLQ MLSGDPHLKA
1010 1020 1030 1040 1050
AHIPENAKDR IPGIVPMQIP SPEVFEELIK FSFHTNVLED NIGYLRFDMF
1060 1070 1080 1090 1100
GDGELLTQVS RLLVEHIWKK IMHTDAMIID MRFNIGGPTS SIPILCSYFF
1110 1120 1130 1140 1150
DEGPPVLLDK IYSRPDDSVS ELWTHAQVVG ERYGSKKSMV ILTSSVTAGT
1160 1170 1180 1190 1200
AEEFTYIMKR LGRALVIGEV TSGGCQPPQT YHVDDTNLYL TIPTARSVGA
1210 1220 1230 1240
SDGSSWEGVG VTPHVVVPAE EALARAKEML QHNQLRVKRS PGLQDHL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again