Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P14373 Zinc finger protein RFP n=156 Tax=Eutheria TaxID=9347 RepID=TRI27_HUMAN MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETF PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDR SREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQ QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP

Members

List component clusters with 100% or 90% identity.
1 to 25 of 156  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P14373TRI27_HUMANZinc finger protein RFPHomo sapiens (Human)9606UniRef100_P14373
UniRef90_P14373
513Representative
Q62158TRI27_MOUSEZinc finger protein RFPMus musculus (Mouse)10090UniRef100_Q62158
UniRef90_P14373
513
A0A1U9X8R9A0A1U9X8R9_HUMANTRIM27Homo sapiens (Human)9606UniRef100_P14373
UniRef90_P14373
513
K7EUW2K7EUW2_PONABTRIM27 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P14373
UniRef90_P14373
513
F7DCK3F7DCK3_MACMURet finger proteinMacaca mulatta (Rhesus macaque)9544UniRef100_P14373
UniRef90_P14373
513
H2QSK5H2QSK5_PANTRTRIM27 isoform 4Pan troglodytes (Chimpanzee)9598UniRef100_P14373
UniRef90_P14373
513
A0A2K6Q3B6A0A2K6Q3B6_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_P14373
UniRef90_P14373
513
A0A2K5N1H5A0A2K5N1H5_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_P14373
UniRef90_P14373
513
A0A096NLL9A0A096NLL9_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_P14373
UniRef90_P14373
513
A0A2R9BGL3A0A2R9BGL3_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_P14373
UniRef90_P14373
513
A0A0D9R6T3A0A0D9R6T3_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_P14373
UniRef90_P14373
513
A0A2K5YG76A0A2K5YG76_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_P14373
UniRef90_P14373
513
A0A2I3HN16A0A2I3HN16_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_P14373
UniRef90_P14373
513
G3RIJ4G3RIJ4_GORGOTripartite motif containing 27Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_P14373
UniRef90_P14373
513
A0A2K5TQT7A0A2K5TQT7_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_P14373
UniRef90_P14373
513
A0A2K6K2G8A0A2K6K2G8_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_P14373
UniRef90_P14373
513
A0A2K6B8E9A0A2K6B8E9_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_P14373
UniRef90_P14373
513
A0A2K5KG03A0A2K5KG03_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_P14373
UniRef90_P14373
513
Q9NZT8Q9NZT8_HUMANRFP transforming protein (Fragment)Homo sapiens (Human)9606UniRef100_P14373
UniRef90_P14373
47
A0A0G2JIZ4A0A0G2JIZ4_HUMANZinc finger protein RFP (Fragment)Homo sapiens (Human)9606UniRef100_P14373
UniRef90_P14373
249
G1M5J4G1M5J4_AILMETripartite motif containing 27Ailuropoda melanoleuca (Giant panda)9646UniRef100_G1M5J4
UniRef90_P14373
563
D2I0J3D2I0J3_AILMEUncharacterized protein (Fragment)Ailuropoda melanoleuca (Giant panda)9646UniRef100_G1M5J4
UniRef90_P14373
513
L8I2Y3L8I2Y3_9CETAZinc finger protein RFP (Fragment)Bos mutus (wild yak)72004UniRef100_L8I2Y3
UniRef90_P14373
563
A0A3Q2LKZ6A0A3Q2LKZ6_HORSETripartite motif containing 27Equus caballus (Horse)9796UniRef100_A0A3Q2LKZ6
UniRef90_P14373
536
A0A3Q7V0K4A0A3Q7V0K4_URSARzinc finger protein RFP isoform X1Ursus arctos horribilis116960UniRef100_A0A3Q7V0K4
UniRef90_P14373
521

Sequence

Representative sequenceiLengthMass (Da)Tools
P14373

Checksumi: 6F963D9048D8A731

FASTA51358,490
        10         20         30         40         50
MASGSVAECL QQETTCPVCL QYFAEPMMLD CGHNICCACL ARCWGTAETN
60 70 80 90 100
VSCPQCRETF PQRHMRPNRH LANVTQLVKQ LRTERPSGPG GEMGVCEKHR
110 120 130 140 150
EPLKLYCEED QMPICVVCDR SREHRGHSVL PLEEAVEGFK EQIQNQLDHL
160 170 180 190 200
KRVKDLKKRR RAQGEQARAE LLSLTQMERE KIVWEFEQLY HSLKEHEYRL
210 220 230 240 250
LARLEELDLA IYNSINGAIT QFSCNISHLS SLIAQLEEKQ QQPTRELLQD
260 270 280 290 300
IGDTLSRAER IRIPEPWITP PDLQEKIHIF AQKCLFLTES LKQFTEKMQS
310 320 330 340 350
DMEKIQELRE AQLYSVDVTL DPDTAYPSLI LSDNLRQVRY SYLQQDLPDN
360 370 380 390 400
PERFNLFPCV LGSPCFIAGR HYWEVEVGDK AKWTIGVCED SVCRKGGVTS
410 420 430 440 450
APQNGFWAVS LWYGKEYWAL TSPMTALPLR TPLQRVGIFL DYDAGEVSFY
460 470 480 490 500
NVTERCHTFT FSHATFCGPV RPYFSLSYSG GKSAAPLIIC PMSGIDGFSG
510
HVGNHGHSME TSP
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again