Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P15170 Eukaryotic peptide chain release factor GTP-binding subunit ERF3A n=630 Tax=Euteleostomi TaxID=117571 RepID=ERF3A_HUMAN MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKP KSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRET WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAV LVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEK LVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDG PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGE NLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCI EEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLR DEGKTIAIGKVLKLVPEKD

Members

List component clusters with 100% or 90% identity.
1 to 25 of 630  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P15170ERF3A_HUMANEukaryotic peptide chain release factor GTP-binding subunit ERF3AHomo sapiens (Human)9606UniRef100_P15170
UniRef90_P15170
499Representative
Q8R050ERF3A_MOUSEEukaryotic peptide chain release factor GTP-binding subunit ERF3AMus musculus (Mouse)10090UniRef100_Q8R050
UniRef90_P15170
636
Q149F3ERF3B_MOUSEEukaryotic peptide chain release factor GTP-binding subunit ERF3BMus musculus (Mouse)10090UniRef100_Q149F3
UniRef90_Q149F3
632
Q8IYD1ERF3B_HUMANEukaryotic peptide chain release factor GTP-binding subunit ERF3BHomo sapiens (Human)9606UniRef100_Q8IYD1
UniRef90_Q8IYD1
628
Q5R4B3ERF3B_PONABEukaryotic peptide chain release factor GTP-binding subunit ERF3BPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5R4B3
UniRef90_Q8IYD1
628
H2NQ64H2NQ64_PONABG1 to S phase transition 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P15170
UniRef90_P15170
689
K9KG45K9KG45_HORSEEukaryotic peptide chain release factor GTP-binding subunit ERF3A-like protein (Fragment)Equus caballus (Horse)9796UniRef100_P15170
UniRef90_P15170
137
A0A2J8R3M8A0A2J8R3M8_PONABGSPT1 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P15170
UniRef90_P15170
499
A0A2J8L9S5A0A2J8L9S5_PANTRGSPT1 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_P15170
UniRef90_P15170
499
A0A2I3FS61A0A2I3FS61_NOMLETr-type G domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_P15170
UniRef90_P15170
499
A0A2K6ESY9A0A2K6ESY9_PROCOTr-type G domain-containing proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6ESY9
UniRef90_P15170
643
L5KRG3L5KRG3_PTEALEukaryotic peptide chain release factor GTP-binding subunit ERF3BPteropus alecto (Black flying fox)9402UniRef100_L5KRG3
UniRef90_P15170
643
A0A2J8R3N9A0A2J8R3N9_PONABGSPT1 isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8R3N9
UniRef90_P15170
642
A0A2I3MVG6A0A2I3MVG6_PAPANTr-type G domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3MVG6
UniRef90_P15170
640
A0A2I3GUB6A0A2I3GUB6_NOMLETr-type G domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3GUB6
UniRef90_P15170
640
A0A096NLR6A0A096NLR6_PAPANTr-type G domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A096NLR6
UniRef90_P15170
640
A0A2K5Y074A0A2K5Y074_MANLETr-type G domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A096NLR6
UniRef90_P15170
519
H9F8A3H9F8A3_MACMUEukaryotic peptide chain release factor GTP-binding subunit ERF3A isoform 1 (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_A0A096NLR6
UniRef90_P15170
590
A0A0D9R7B0A0A0D9R7B0_CHLSBTr-type G domain-containing proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9R7B0
UniRef90_P15170
639
A0A341BCY0A0A341BCY0_9CETAeukaryotic peptide chain release factor GTP-binding subunit ERF3A isoform X1Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_A0A341BCY0
UniRef90_P15170
639
A0A2Y9LGL7A0A2Y9LGL7_DELLEeukaryotic peptide chain release factor GTP-binding subunit ERF3A isoform X2Delphinapterus leucas (Beluga whale)9749UniRef100_A0A341BCY0
UniRef90_P15170
499
A0A2Y9LE63A0A2Y9LE63_DELLEeukaryotic peptide chain release factor GTP-binding subunit ERF3A isoform X1Delphinapterus leucas (Beluga whale)9749UniRef100_A0A2Y9LE63
UniRef90_P15170
639
A0A2K6C3X4A0A2K6C3X4_MACNETr-type G domain-containing proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6C3X4
UniRef90_P15170
639
A0A2Y9DES3A0A2Y9DES3_TRIMAeukaryotic peptide chain release factor GTP-binding subunit ERF3ATrichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9DES3
UniRef90_P15170
639
G3UKB5G3UKB5_LOXAFG1 to S phase transition 1Loxodonta africana (African elephant)9785UniRef100_G3UKB5
UniRef90_P15170
638

Sequence

Representative sequenceiLengthMass (Da)Tools
P15170

Checksumi: DE20482CCABC3576

FASTA49955,756
        10         20         30         40         50
MELSEPIVEN GETEMSPEES WEHKEEISEA EPGGGSLGDG RPPEESAHEM
60 70 80 90 100
MEEEEEIPKP KSVVAPPGAP KKEHVNVVFI GHVDAGKSTI GGQIMYLTGM
110 120 130 140 150
VDKRTLEKYE REAKEKNRET WYLSWALDTN QEERDKGKTV EVGRAYFETE
160 170 180 190 200
KKHFTILDAP GHKSFVPNMI GGASQADLAV LVISARKGEF ETGFEKGGQT
210 220 230 240 250
REHAMLAKTA GVKHLIVLIN KMDDPTVNWS NERYEECKEK LVPFLKKVGF
260 270 280 290 300
NPKKDIHFMP CSGLTGANLK EQSDFCPWYI GLPFIPYLDN LPNFNRSVDG
310 320 330 340 350
PIRLPIVDKY KDMGTVVLGK LESGSICKGQ QLVMMPNKHN VEVLGILSDD
360 370 380 390 400
VETDTVAPGE NLKIRLKGIE EEEILPGFIL CDPNNLCHSG RTFDAQIVII
410 420 430 440 450
EHKSIICPGY NAVLHIHTCI EEVEITALIC LVDKKSGEKS KTRPRFVKQD
460 470 480 490
QVCIARLRTA GTICLETFKD FPQMGRFTLR DEGKTIAIGK VLKLVPEKD
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again