Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P15941-16 Isoform E2 of Mucin-1 n=9 Tax=Hominoidea TaxID=314295 RepID=Isoform 16 of MUC1_HUMAN MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEK NASGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEY PTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL

Members

List component clusters with 100% or 90% identity.
1 to 9 of 9  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P15941-16Isoform 16 of MUC1_HUMANE2Homo sapiens (Human)9606UniRef100_P15941-16
UniRef90_P15941-16
166Representative
A0A2I3H8I2A0A2I3H8I2_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3H8I2
UniRef90_P15941-16
189
A6ZIE4A6ZIE4_HUMANMUC1 isoform M10Homo sapiens (Human)9606UniRef100_A6ZIE4
UniRef90_P15941-16
189Seed
A0A2I2YZK4A0A2I2YZK4_GORGOMucin 1, cell surface associatedGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2YZK4
UniRef90_P15941-16
189
A0A2J8Q2Y5A0A2J8Q2Y5_PANTRMUC1 isoform 7Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8Q2Y5
UniRef90_P15941-16
189
A0A2J8VG96A0A2J8VG96_PONABMUC1 isoform 5Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VG96
UniRef90_P15941-16
189
A0A2J8Q2X4A0A2J8Q2X4_PANTRMUC1 isoform 22Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8Q2X4
UniRef90_P15941-16
166
A0A2J8VGF9A0A2J8VGF9_PONABMUC1 isoform 20Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8VGF9
UniRef90_P15941-16
166
Q7Z549Q7Z549_HUMANMucin short variant E1Homo sapiens (Human)9606UniRef100_Q7Z549
UniRef90_P15941-16
157

Sequence

Representative sequenceiLengthMass (Da)Tools
P15941-16

Checksumi: BF6C969984986AD0

FASTA16617,287
        10         20         30         40         50
MTPGTQSPFF LLLLLTVLTA TTAPKPATVV TGSGHASSTP GGEKETSATQ
60 70 80 90 100
RSSVPSSTEK NASGAGVPGW GIALLVLVCV LVALAIVYLI ALAVCQCRRK
110 120 130 140 150
NYGQLDIFPA RDTYHPMSEY PTYHTHGRYV PPSSTDRSPY EKVSAGNGGS
160
SLSYTNPAVA ATSANL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again