Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P16104 Histone H2AX n=195 Tax=Opisthokonta TaxID=33154 RepID=H2AX_HUMAN MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TSATVGPKAPSGGKKATQASQEY

Members

List component clusters with 100% or 90% identity.
1 to 25 of 195  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P16104H2AX_HUMANHistone H2AXHomo sapiens (Human)9606UniRef100_P16104
UniRef90_P16104
143Representative
U3CDD7U3CDD7_CALJAHistone H2ACallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_P16104
UniRef90_P16104
143
K6ZAK5K6ZAK5_PANTRHistone H2APan troglodytes (Chimpanzee)9598UniRef100_P16104
UniRef90_P16104
143
A0A1D5Q5B3A0A1D5Q5B3_MACMUHistone H2AMacaca mulatta (Rhesus macaque)9544UniRef100_P16104
UniRef90_P16104
143
G7PPA0G7PPA0_MACFAHistone H2AMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_P16104
UniRef90_P16104
143
A0A2J8X0N8A0A2J8X0N8_PONABHistone H2APongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P16104
UniRef90_P16104
143
A0A2K6S5E4A0A2K6S5E4_SAIBBHistone H2ASaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_P16104
UniRef90_P16104
143
A0A2K5PE66A0A2K5PE66_CEBCAHistone H2ACebus capucinus imitator1737458UniRef100_P16104
UniRef90_P16104
143
A0A2K5HE74A0A2K5HE74_COLAPHistone H2AColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_P16104
UniRef90_P16104
143
A0A2K5KXP0A0A2K5KXP0_CERATHistone H2ACercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_P16104
UniRef90_P16104
143
A0A2K6N9R8A0A2K6N9R8_RHIROHistone H2ARhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_P16104
UniRef90_P16104
143
A0A096N7R2A0A096N7R2_PAPANHistone H2APapio anubis (Olive baboon)9555UniRef100_P16104
UniRef90_P16104
143
A0A0D9S972A0A0D9S972_CHLSBHistone H2AChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_P16104
UniRef90_P16104
143
A0A2K5XDM8A0A2K5XDM8_MANLEHistone H2AMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_P16104
UniRef90_P16104
143
G3QYE9G3QYE9_GORGOHistone H2AGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_P16104
UniRef90_P16104
143
A0A2K6JYN0A0A2K6JYN0_RHIBEHistone H2ARhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_P16104
UniRef90_P16104
143
A0A2K6AZQ4A0A2K6AZQ4_MACNEHistone H2AMacaca nemestrina (Pig-tailed macaque)9545UniRef100_P16104
UniRef90_P16104
143
G3W8C9G3W8C9_SARHAHistone H2ASarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius)9305UniRef100_G3W8C9
UniRef90_P16104
145
A0A1U7UKR6A0A1U7UKR6_TARSYHistone H2ATarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7UKR6
UniRef90_P16104
143
A0A091DIY6A0A091DIY6_FUKDAHistone H2AFukomys damarensis (Damaraland mole rat) (Cryptomys damarensis)885580UniRef100_A0A091DIY6
UniRef90_P16104
143
G3I968G3I968_CRIGRHistone H2ACricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef100_A0A091DIY6
UniRef90_P16104
143
A0A2Y9E3F4A0A2Y9E3F4_TRIMAHistone H2ATrichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9E3F4
UniRef90_P16104
143
D3ZXP3D3ZXP3_RATHistone H2ARattus norvegicus (Rat)10116UniRef100_D3ZXP3
UniRef90_P16104
143
H9FTN1H9FTN1_MACMUHistone H2AMacaca mulatta (Rhesus macaque)9544UniRef100_H9FTN1
UniRef90_P16104
143
H9F5S1H9F5S1_MACMUHistone H2A (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_H9FTN1
UniRef90_P16104
76

Sequence

Representative sequenceiLengthMass (Da)Tools
P16104

Checksumi: D4683775C2E6C3A9

FASTA14315,145
        10         20         30         40         50
MSGRGKTGGK ARAKAKSRSS RAGLQFPVGR VHRLLRKGHY AERVGAGAPV
60 70 80 90 100
YLAAVLEYLT AEILELAGNA ARDNKKTRII PRHLQLAIRN DEELNKLLGG
110 120 130 140
VTIAQGGVLP NIQAVLLPKK TSATVGPKAP SGGKKATQAS QEY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again