Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P16905 cAMP-dependent protein kinase type I regulatory subunit n=396 Tax=Metazoa TaxID=33208 RepID=KAPR1_DROME MSYMMAKTLEEQSLRECEHYIQTHGIQRVLKDCIVQLCVCRPENPVQFLRQYFQKLEREQ VKLDASRQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTM NALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVF VNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKM YEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQ RSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADI LKRNITQYNSFVSLSV

Members

List component clusters with 100% or 90% identity.
1 to 25 of 396  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P16905KAPR1_DROMEcAMP-dependent protein kinase type I regulatory subunitDrosophila melanogaster (Fruit fly)7227UniRef100_P16905
UniRef90_P16905
376Representative
A0A0Q5UCI6A0A0Q5UCI6_DROERUncharacterized protein, isoform CDrosophila erecta (Fruit fly)7220UniRef100_P16905
UniRef90_P16905
376
A0A0R1E0E6A0A0R1E0E6_DROYAUncharacterized protein, isoform EDrosophila yakuba (Fruit fly)7245UniRef100_P16905
UniRef90_P16905
376
A0A0J9RYY1A0A0J9RYY1_DROSIUncharacterized protein, isoform FDrosophila simulans (Fruit fly)7240UniRef100_P16905
UniRef90_P16905
376
A0A3B0J5D4A0A3B0J5D4_DROGUBlast:cAMP-dependent protein kinase type I regulatory subunitDrosophila guanche (Fruit fly)7266UniRef100_A0A3B0J5D4
UniRef90_P16905
378
Q2M150Q2M150_DROPSUncharacterized protein, isoform GDrosophila pseudoobscura pseudoobscura (Fruit fly)46245UniRef100_Q2M150
UniRef90_P16905
378
A0A1W4UNR8A0A1W4UNR8_DROFCcAMP-dependent protein kinase type I regulatory subunit isoform X1Drosophila ficusphila (Fruit fly)30025UniRef100_A0A1W4UNR8
UniRef90_P16905
377
A0A0Q9WHJ0A0A0Q9WHJ0_DROVIUncharacterized protein, isoform BDrosophila virilis (Fruit fly)7244UniRef100_A0A0Q9WHJ0
UniRef90_P16905
377
M9MRY3M9MRY3_DROMEProtein kinase, cAMP-dependent, regulatory subunit type 1, isoform AADrosophila melanogaster (Fruit fly)7227UniRef100_M9MRY3
UniRef90_P16905
377
A0A0Q5UKR3A0A0Q5UKR3_DROERUncharacterized protein, isoform HDrosophila erecta (Fruit fly)7220UniRef100_M9MRY3
UniRef90_P16905
377
A0A0R1DYT5A0A0R1DYT5_DROYAUncharacterized protein, isoform GDrosophila yakuba (Fruit fly)7245UniRef100_M9MRY3
UniRef90_P16905
377
A0A0J9RZ66A0A0J9RZ66_DROSIUncharacterized protein, isoform LDrosophila simulans (Fruit fly)7240UniRef100_M9MRY3
UniRef90_P16905
377
B4GUN6B4GUN6_DROPEGL24352Drosophila persimilis (Fruit fly)7234UniRef100_B4GUN6
UniRef90_P16905
377
A0A0Q9X1V6A0A0Q9X1V6_DROWIUncharacterized protein, isoform BDrosophila willistoni (Fruit fly)7260UniRef100_A0A0Q9X1V6
UniRef90_P16905
377
A0A0N8P0W0A0A0N8P0W0_DROANUncharacterized protein, isoform CDrosophila ananassae (Fruit fly)7217UniRef100_A0A0N8P0W0
UniRef90_P16905
377
A0A0P8XU40A0A0P8XU40_DROANUncharacterized protein, isoform DDrosophila ananassae (Fruit fly)7217UniRef100_A0A0N8P0W0
UniRef90_P16905
297
A0A1W4UNZ6A0A1W4UNZ6_DROFCcAMP-dependent protein kinase type I regulatory subunit isoform X2Drosophila ficusphila (Fruit fly)30025UniRef100_A0A1W4UNZ6
UniRef90_P16905
376
B4N3W7B4N3W7_DROWIUncharacterized protein, isoform ADrosophila willistoni (Fruit fly)7260UniRef100_B4N3W7
UniRef90_P16905
376
B4J0Z0B4J0Z0_DROGRGH15909Drosophila grimshawi (Hawaiian fruit fly) (Idiomyia grimshawi)7222UniRef100_B4J0Z0
UniRef90_P16905
376
A0A0P9AK35A0A0P9AK35_DROANUncharacterized protein, isoform BDrosophila ananassae (Fruit fly)7217UniRef100_A0A0P9AK35
UniRef90_P16905
376
B4LB63B4LB63_DROVIUncharacterized protein, isoform ADrosophila virilis (Fruit fly)7244UniRef100_B4LB63
UniRef90_P16905
376
A0A0Q9X401A0A0Q9X401_DROWIUncharacterized protein, isoform CDrosophila willistoni (Fruit fly)7260UniRef100_A0A0Q9X401
UniRef90_P16905
322
I5AMQ5I5AMQ5_DROPSUncharacterized protein, isoform HDrosophila pseudoobscura pseudoobscura (Fruit fly)46245UniRef100_I5AMQ5
UniRef90_P16905
322
A0A0Q9WTE7A0A0Q9WTE7_DROVIUncharacterized protein, isoform CDrosophila virilis (Fruit fly)7244UniRef100_A0A0Q9WTE7
UniRef90_P16905
322
A0A1W4UCA1A0A1W4UCA1_DROFCcAMP-dependent protein kinase type I regulatory subunit isoform X3Drosophila ficusphila (Fruit fly)30025UniRef100_A0A1W4UCA1
UniRef90_P16905
322

Sequence

Representative sequenceiLengthMass (Da)Tools
P16905

Checksumi: F7B89D9C3EC313A5

FASTA37642,239
        10         20         30         40         50
MSYMMAKTLE EQSLRECEHY IQTHGIQRVL KDCIVQLCVC RPENPVQFLR
60 70 80 90 100
QYFQKLEREQ VKLDASRQVI SPDDCEDLSP MPQTAAPPVR RRGGISAEPV
110 120 130 140 150
TEEDATNYVK KVVPKDYKTM NALSKAIAKN VLFAHLDESE RSDIFDAMFP
160 170 180 190 200
VNHIAGENII QQGDEGDNFY VIDVGEVDVF VNSELVTTIS EGGSFGELAL
210 220 230 240 250
IYGTPRAATV RAKTDVKLWG IDRDSYRRIL MGSTIRKRKM YEEFLSRVSI
260 270 280 290 300
LESLDKWERL TVADSLETCS FDDGETIVKQ GAAGDDFYII LEGCAVVLQQ
310 320 330 340 350
RSEGEDPAEV GRLGSSDYFG EIALLLDRPR AATVVARGPL KCVKLDRARF
360 370
ERVLGPCADI LKRNITQYNS FVSLSV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again