Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P17855 Staphylocoagulase n=642 Tax=Bacillales TaxID=1385 RepID=STC2_STAAU MKKQIISLGALAVASSLFTWDNKADAIVTKDYSKESRVNENSKYGTLISDWYLKGRLTSL ESQFINALDILETYHYGEKEYKDAKDKLMTRILGEDQYLLERKKVQYEEYKKLYQKYKEE NPTSKGLKLKTFDQYTIEDLTMREYNELTESLKSAVKDFEKDVEKIENQHHDLKPFTDEM EEKATSRVDDLANKAYSVYFAFVRDTQHKTEALELKAKVDLVLGDEDKPHRISNERIEKE MIKDLESIIEDFFIETGLNKPGNITSYDSSKHHYKNHSEGFEALVKETREAVANADESWK TKTVKKYGESETKSPVVKEENKVEDPQSPKFDNQQEVKTTAGKAEETTQPVAQPLVKIPQ GTITGEIVKGPEYPTMENKTLQGEIVQGPDFPTMEQSGPSLSDNYTQPTTPNPILEGLEG SSSKLEIKPQGTESTLKGIQGESSDIEVKPQATETTEASQYGPRPQFNKTPKYVKYRDAG TGIREYNDGTFGYEARPRFNKPSETNAYNVTTNQDGTVSYGARPTQNKASETNAYNVTTH ANGQVSYGARPTQKKPSETNAYNVTTHANGQVSYGARPTYNKPSETNAYNVTTHGNGQVS YGARPTYKKPSKTNAYNVTTHANGQVSYGARPTQNKPSETNAYNVTTHANGQVSYGARPT QNKPSETNAYNVTTHGNGQVSYGARPTYNKPSKTNAYNVTTHADGTATYGPRVTK

Members

List component clusters with 100% or 90% identity.
1 to 25 of 642  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P17855STC2_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_P17855
UniRef90_P17855
715Representative
C4B815C4B815_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_C4B815
UniRef90_P17855
714
Q9ADR4Q9ADR4_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_C4B815
UniRef90_P17855
459
C4B4N2C4B4N2_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_C4B4N2
UniRef90_P17855
714
A0A447ZJQ7A0A447ZJQ7_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_A0A447ZJQ7
UniRef90_P17855
687
Q4W8L9Q4W8L9_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_Q4W8L9
UniRef90_P17855
686
Q9KW84Q9KW84_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_Q4W8L9
UniRef90_P17855
194
C4B841C4B841_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_C4B841
UniRef90_P17855
678
C1IDU8C1IDU8_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_C1IDU8
UniRef90_P17855
678
Q846V4Q846V4_STAAUStaphylocoagulase (Fragment)Staphylococcus aureus1280UniRef100_Q846V4
UniRef90_P17855
660
C4B4T1C4B4T1_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_C4B4T1
UniRef90_C4B4T1
657
A0A380BM14A0A380BM14_9STAPStaphylocoagulaseStaphylococcus argenteus985002UniRef100_C4B4T1
UniRef90_C4B4T1
657
C1IDV1C1IDV1_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_C1IDV1
UniRef90_C4B4Q4
653
C4B4Q4C4B4Q4_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_C4B4Q4
UniRef90_C4B4Q4
653
T1Y625T1Y625_STAAUStaphylocoagulaseStaphylococcus aureus subsp. aureus CN11193576UniRef100_C4B4Q4
UniRef90_C4B4Q4
653
A0A1D4KY23A0A1D4KY23_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_A0A1D4KY23
UniRef90_C4B4Q4
626
Q9ADR0Q9ADR0_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_Q9ADR0
UniRef90_C4B4Q4
452
Q4W8J9Q4W8J9_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_Q4W8J9
UniRef90_Q4W8J9
663
Q9KW69Q9KW69_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_Q4W8J9
UniRef90_Q4W8J9
167
Q9ADR2Q9ADR2_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_Q9ADR2
UniRef90_Q4W8J9
462
B6VQX2B6VQX2_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_B6VQX2
UniRef90_B6VQX2
678
A0A0U1MVV6A0A0U1MVV6_STAAUStaphylocoagulaseStaphylococcus aureus1280UniRef100_A0A0U1MVV6
UniRef90_B6VQX2
678
Q9ADR6Q9ADR6_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_A0A0U1MVV6
UniRef90_B6VQX2
477
C1IDV2C1IDV2_STAAUType XII staphylocoagulaseStaphylococcus aureus1280UniRef100_C1IDV2
UniRef90_Q4W8L5
681
A0A068FGJ5A0A068FGJ5_STAAUCoagulase (Fragment)Staphylococcus aureus1280UniRef100_C1IDV2
UniRef90_Q4W8L5
169

Sequence

Representative sequenceiLengthMass (Da)Tools
P17855

Checksumi: 46ABC9567AF5F128

FASTA71580,100
        10         20         30         40         50
MKKQIISLGA LAVASSLFTW DNKADAIVTK DYSKESRVNE NSKYGTLISD
60 70 80 90 100
WYLKGRLTSL ESQFINALDI LETYHYGEKE YKDAKDKLMT RILGEDQYLL
110 120 130 140 150
ERKKVQYEEY KKLYQKYKEE NPTSKGLKLK TFDQYTIEDL TMREYNELTE
160 170 180 190 200
SLKSAVKDFE KDVEKIENQH HDLKPFTDEM EEKATSRVDD LANKAYSVYF
210 220 230 240 250
AFVRDTQHKT EALELKAKVD LVLGDEDKPH RISNERIEKE MIKDLESIIE
260 270 280 290 300
DFFIETGLNK PGNITSYDSS KHHYKNHSEG FEALVKETRE AVANADESWK
310 320 330 340 350
TKTVKKYGES ETKSPVVKEE NKVEDPQSPK FDNQQEVKTT AGKAEETTQP
360 370 380 390 400
VAQPLVKIPQ GTITGEIVKG PEYPTMENKT LQGEIVQGPD FPTMEQSGPS
410 420 430 440 450
LSDNYTQPTT PNPILEGLEG SSSKLEIKPQ GTESTLKGIQ GESSDIEVKP
460 470 480 490 500
QATETTEASQ YGPRPQFNKT PKYVKYRDAG TGIREYNDGT FGYEARPRFN
510 520 530 540 550
KPSETNAYNV TTNQDGTVSY GARPTQNKAS ETNAYNVTTH ANGQVSYGAR
560 570 580 590 600
PTQKKPSETN AYNVTTHANG QVSYGARPTY NKPSETNAYN VTTHGNGQVS
610 620 630 640 650
YGARPTYKKP SKTNAYNVTT HANGQVSYGA RPTQNKPSET NAYNVTTHAN
660 670 680 690 700
GQVSYGARPT QNKPSETNAY NVTTHGNGQV SYGARPTYNK PSKTNAYNVT
710
THADGTATYG PRVTK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again