Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P17870-2 Isoform 1B of Beta-arrestin-1 n=262 Tax=Bilateria TaxID=33213 RepID=Isoform 2 of ARRB1_BOVIN MGDKAGTRVFKKSSPNCKVTVYLGKRDFVDHLDQVDPVDGVILVDPEYLKDRKVFVTLTC AFRYGREDLDVLGLSFRKDLYISTFQAFPPIAEERKANSRLQERLLKKLGQQAHPFYFTI PQNLPCSVTLQPGPEDTGKACGVDFEIRAFCAKSIEEKIHKRNSVRLVIRKVQYAPEKPG PQPMVETTRSFLMSDRSLHLEASLDKELYYHGEPISVNVHVTNNSTKTVKRLKISVRQYA DICLFSTAQYKCPVAQVEADDQVSSSSTFCKVYTLTPTLDKNREKRGLALDGKLKHEDTN LASSTIVKDVTNKEVLGILVSYRVKVKLVISRGGLLSGVLERDVSVELPFVLMHPKPTEL PISRPQSAVPDSDPPIDTNLIEFETNSFSQDDDFVFEDFARLRLKGMADDKDDDC

Members

List component clusters with 100% or 90% identity.
1 to 25 of 262  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P17870-2Isoform 2 of ARRB1_BOVIN1BBos taurus (Bovine)9913UniRef100_P17870-2
UniRef90_P17870-2
410Representative
P51468ARR3_ONCMYArrestin red cell isoform 3Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)8022UniRef100_P51468
UniRef90_P51468
415
P51466ARR1_ONCMYArrestin red cell isoform 1Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)8022UniRef100_P51466
UniRef90_P51468
407
P51467ARR2_ONCMYArrestin red cell isoform 2Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)8022UniRef100_P51467
UniRef90_P51468
405
A0A4W2EJZ1A0A4W2EJZ1_BOBOXArrestin_C domain-containing proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_P17870-2
UniRef90_P17870-2
410
A0A4X2LJP5A0A4X2LJP5_VOMURArrestin beta 1Vombatus ursinus (Common wombat)29139UniRef100_A0A4X2LJP5
UniRef90_P17870-2
415
A0A452EHT6A0A452EHT6_CAPHIArrestin_C domain-containing proteinCapra hircus (Goat)9925UniRef100_A0A452EHT6
UniRef90_P17870-2
410
A0A3Q1LPK1A0A3Q1LPK1_BOVINBeta-arrestin-1Bos taurus (Bovine)9913UniRef100_A0A3Q1LPK1
UniRef90_A0A3Q1LPK1
513
A0A4W2EJZ0A0A4W2EJZ0_BOBOXArrestin_C domain-containing proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A3Q1LPK1
UniRef90_A0A3Q1LPK1
513
A0A452DJU4A0A452DJU4_BOVINBeta-arrestin-1Bos taurus (Bovine)9913UniRef100_A0A452DJU4
UniRef90_A0A3Q1LPK1
505
A0A4W2ED79A0A4W2ED79_BOBOXArrestin_C domain-containing proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2ED79
UniRef90_A0A3Q1LPK1
483
A0A4W2CYT3A0A4W2CYT3_BOBOXArrestin_C domain-containing proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_A0A4W2CYT3
UniRef90_A0A3Q1LPK1
473
A0A1S3T2T3A0A1S3T2T3_SALSAbeta-arrestin-1 isoform X3Salmo salar (Atlantic salmon)8030UniRef100_A0A1S3T2T3
UniRef90_A0A1S3T2T1
467
A0A1S3T2T1A0A1S3T2T1_SALSAbeta-arrestin-1 isoform X1Salmo salar (Atlantic salmon)8030UniRef100_A0A1S3T2T1
UniRef90_A0A1S3T2T1
503
A0A1S3T2T4A0A1S3T2T4_SALSAbeta-arrestin-1 isoform X2Salmo salar (Atlantic salmon)8030UniRef100_A0A1S3T2T4
UniRef90_A0A1S3T2T1
497
A0A1S3T2T9A0A1S3T2T9_SALSAbeta-arrestin-1 isoform X4Salmo salar (Atlantic salmon)8030UniRef100_A0A1S3T2T9
UniRef90_A0A1S3T2T1
421
A0A1S3T2T5A0A1S3T2T5_SALSAbeta-arrestin-1 isoform X5Salmo salar (Atlantic salmon)8030UniRef100_A0A1S3T2T5
UniRef90_A0A1S3T2T1
415
A0A3B4DL71A0A3B4DL71_PYGNAArrestin_C domain-containing proteinPygocentrus nattereri (Red-bellied piranha)42514UniRef100_A0A3B4DL71
UniRef90_A0A087XZ26
418
A0A3B3SLG4A0A3B3SLG4_9TELEArrestin_C domain-containing proteinParamormyrops kingsleyae1676925UniRef100_A0A3B3SLG4
UniRef90_A0A087XZ26
418
A0A1A8D2H0A0A1A8D2H0_9TELEArrestin, beta 1Nothobranchius kadleci1051664UniRef100_A0A1A8D2H0
UniRef90_A0A087XZ26
417
A0A1A8QBA0A0A1A8QBA0_9TELEArrestin, beta 1Nothobranchius pienaari704102UniRef100_A0A1A8D2H0
UniRef90_A0A087XZ26
417
A0A1A8GDG2A0A1A8GDG2_9TELEArrestin, beta 1Nothobranchius korthausae1143690UniRef100_A0A1A8D2H0
UniRef90_A0A087XZ26
417
A0A1A8SF95A0A1A8SF95_9TELEArrestin, beta 1Nothobranchius rachovii (bluefin notho)451742UniRef100_A0A1A8D2H0
UniRef90_A0A087XZ26
417
A0A1A8FN65A0A1A8FN65_9TELEArrestin, beta 1 (Fragment)Nothobranchius korthausae1143690UniRef100_A0A1A8D2H0
UniRef90_A0A087XZ26
253
A0A087XZ26A0A087XZ26_POEFOArrestin_C domain-containing proteinPoecilia formosa (Amazon molly) (Limia formosa)48698UniRef100_A0A087XZ26
UniRef90_A0A087XZ26
417

Sequence

Representative sequenceiLengthMass (Da)Tools
P17870-2

Checksumi: 7797256F17A2FBC8

FASTA41546,771
        10         20         30         40         50
MGDKAGTRVF KKSSPNCKVT VYLGKRDFVD HLDQVDPVDG VILVDPEYLK
60 70 80 90 100
DRKVFVTLTC AFRYGREDLD VLGLSFRKDL YISTFQAFPP IAEERKANSR
110 120 130 140 150
LQERLLKKLG QQAHPFYFTI PQNLPCSVTL QPGPEDTGKA CGVDFEIRAF
160 170 180 190 200
CAKSIEEKIH KRNSVRLVIR KVQYAPEKPG PQPMVETTRS FLMSDRSLHL
210 220 230 240 250
EASLDKELYY HGEPISVNVH VTNNSTKTVK RLKISVRQYA DICLFSTAQY
260 270 280 290 300
KCPVAQVEAD DQVSSSSTFC KVYTLTPTLD KNREKRGLAL DGKLKHEDTN
310 320 330 340 350
LASSTIVKDV TNKEVLGILV SYRVKVKLVI SRGGLLSGVL ERDVSVELPF
360 370 380 390 400
VLMHPKPTEL PISRPQSAVP DSDPPIDTNL IEFETNSFSQ DDDFVFEDFA
410
RLRLKGMADD KDDDC
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again