Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P21525 Transcription factor kayak, isoforms A/B/F n=38 Tax=Drosophilinae TaxID=43845 RepID=FOSLA_DROME MKNLNGRTHNACYHPYYHQSLHFAQQQQQQQQHHLQQQQQHMQQQQQQQQAPQQQLRHQQ RQLPTQPAYQQSQSVAHNAFPLRSSSNNYGHVASSAYAASSGSHNSNNAAAMAAVCQMQN FFNQQQQQQQQLEFNNNCMPINYYQQQQQQHYPSESQSSASGWNPETPGQAQLALTATTC NTTAAATCNTTAAATTSTTATSAAAGSDNNHSDNFAMDASEIATFLANELFLQQLGNFET GQSVLTLTTPTLTPTTTRNIEDTLGHLLSDTQTDRVAGCAGFAVPKVLPNAIDVLGMGIP TGVSSLPLQQTFDLSLGQGSESEDSNASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMA GSVNGGGVNNFSNVLAAVSSSRGSASVGSSNANTSNTPARRGGGRRPNRSTNMTPEEEQK RAVRRERNKQAAARCRKRRVDQTNELTEEVEQLEKRGESMRKEIEVLTNSKNQLEYLLAT HRATCQKIRSDMLSVVTCNGLIAPAGLLSAGSSGSGASSHHNHNSNDSSNGTITGMDATL NSTGRSNSPLDLKPAANIDSLLMHIKDEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMP HVHLSTILTPTGASSGSLQTPITSTAPGGFGSAFPVTSNGSSINNINSIGNNMNSPTLNA HNKVPKERPNTLAFQRPLGQMHLTMANNKAGGPTQIQGVPIQTPSTGTFNFDSLMDGGTG LTPVSGPLVPNSSSTNKHPLELPTPTAEPSKLVSL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 38  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P21525FOSLA_DROMETranscription factor kayak, isoforms A/B/FDrosophila melanogaster (Fruit fly)7227UniRef100_P21525
UniRef90_P21525
755Representative
B4K617FOSL_DROMOTranscription factor kayakDrosophila mojavensis (Fruit fly)7230UniRef100_B4K617
UniRef90_B4K617
784
Q29AP1FOSL_DROPSTranscription factor kayakDrosophila pseudoobscura pseudoobscura (Fruit fly)46245UniRef100_Q29AP1
UniRef90_Q29AP1
778
B4JYN3FOSL_DROGRTranscription factor kayakDrosophila grimshawi (Hawaiian fruit fly) (Idiomyia grimshawi)7222UniRef100_B4JYN3
UniRef90_B4JYN3
796Seed
B4M5T7FOSL_DROVITranscription factor kayakDrosophila virilis (Fruit fly)7244UniRef100_B4M5T7
UniRef90_B4M5T7
792
A0A0R1E9K8A0A0R1E9K8_DROYAUncharacterized protein, isoform DDrosophila yakuba (Fruit fly)7245UniRef100_A0A0R1E9K8
UniRef90_P21525
771
A0A484BU69A0A484BU69_DRONABZIP domain-containing proteinDrosophila navojoa (Fruit fly)7232UniRef100_A0A484BU69
UniRef90_B4K617
763
A0A1W4URC3A0A1W4URC3_DROFCtranscription factor kayak isoform X1Drosophila ficusphila (Fruit fly)30025UniRef100_A0A1W4URC3
UniRef90_A0A1W4URC3
764
A0A1W4UCD1A0A1W4UCD1_DROFCtranscription factor kayak, isoforms D/sro isoform X2Drosophila ficusphila (Fruit fly)30025UniRef100_A0A1W4UCD1
UniRef90_A0A1W4UCD1
713
Q29AP1-3Isoform 3 of FOSL_DROPSBDrosophila pseudoobscura pseudoobscura (Fruit fly)46245UniRef100_Q29AP1-3
UniRef90_Q29AP1-2
598
Q29AP1-2Isoform 2 of FOSL_DROPSADrosophila pseudoobscura pseudoobscura (Fruit fly)46245UniRef100_Q29AP1-2
UniRef90_Q29AP1-2
738
UPI0007327AB7transcription factor kayak isoform X1Drosophila erecta (Fruit fly)7220UniRef100_UPI0007327AB7
UniRef90_P21525
757
UPI00078AE671uncharacterized protein, isoform DDrosophila simulans (Fruit fly)7240UniRef100_UPI00078AE671
UniRef90_P21525
748
UPI0011BF72B3transcription factor kayak isoform X1Drosophila navojoa (Fruit fly)7232UniRef100_UPI0011BF72B3
UniRef90_B4K617
694
UPI000BA1913Atranscription factor kayak isoform X1Drosophila obscura (Fruit fly)7282UniRef100_UPI000BA1913A
UniRef90_Q29AP1
786
UPI000BA0E3ABtranscription factor kayak isoform X1Drosophila obscura (Fruit fly)7282UniRef100_UPI000BA0E3AB
UniRef90_Q29AP1
786
UPI0007086F22kayakDrosophila pseudoobscura pseudoobscura (Fruit fly)46245UniRef100_Q29AP1
UniRef90_Q29AP1
501
UPI000F081F3Ctranscription factor kayak isoform X1Drosophila persimilis (Fruit fly)7234UniRef100_UPI000F081F3C
UniRef90_Q29AP1
774
UPI0007E85969transcription factor kayak, isoforms D/sro isoform X2Drosophila biarmipes (Fruit fly)125945UniRef100_UPI0007E85969
UniRef90_UPI0007E85969
704
UPI0007E5CF46transcription factor kayak isoform X1Drosophila bipectinata (Fruit fly)42026UniRef100_UPI0007E5CF46
UniRef90_UPI0007E5CF46
734
UPI0011CFAE15transcription factor kayak isoform X1Drosophila lebanonensis (Fruit fly) (Scaptodrosophila lebanonensis)7225UniRef100_UPI0011CFAE15
UniRef90_UPI0011CFAE15
736
UPI0007E5E395transcription factor kayak, isoforms A/B/F isoform X1Drosophila rhopaloa (Fruit fly)1041015UniRef100_UPI0007E5E395
UniRef90_UPI0007E64E5B
734
UPI0007E64E5Btranscription factor kayak, isoforms A/B/F isoform X1Drosophila elegans (Fruit fly)30023UniRef100_UPI0007E64E5B
UniRef90_UPI0007E64E5B
786
UPI0007E39B3DLOW QUALITY PROTEIN: transcription factor kayak, isoforms A/B/FDrosophila suzukii (Spotted-wing drosophila fruit fly)28584UniRef100_UPI0007E39B3D
UniRef90_UPI0007E727C1
740
UPI0007E727C1transcription factor kayak isoform X1Drosophila biarmipes (Fruit fly)125945UniRef100_UPI0007E727C1
UniRef90_UPI0007E727C1
763

Sequence

Representative sequenceiLengthMass (Da)Tools
P21525

Checksumi: 6E21F0460B626DAA

FASTA75580,579
        10         20         30         40         50
MKNLNGRTHN ACYHPYYHQS LHFAQQQQQQ QQHHLQQQQQ HMQQQQQQQQ
60 70 80 90 100
APQQQLRHQQ RQLPTQPAYQ QSQSVAHNAF PLRSSSNNYG HVASSAYAAS
110 120 130 140 150
SGSHNSNNAA AMAAVCQMQN FFNQQQQQQQ QLEFNNNCMP INYYQQQQQQ
160 170 180 190 200
HYPSESQSSA SGWNPETPGQ AQLALTATTC NTTAAATCNT TAAATTSTTA
210 220 230 240 250
TSAAAGSDNN HSDNFAMDAS EIATFLANEL FLQQLGNFET GQSVLTLTTP
260 270 280 290 300
TLTPTTTRNI EDTLGHLLSD TQTDRVAGCA GFAVPKVLPN AIDVLGMGIP
310 320 330 340 350
TGVSSLPLQQ TFDLSLGQGS ESEDSNASYN DTQMNEEQDT TDTSSAHTDS
360 370 380 390 400
TSYQAGHIMA GSVNGGGVNN FSNVLAAVSS SRGSASVGSS NANTSNTPAR
410 420 430 440 450
RGGGRRPNRS TNMTPEEEQK RAVRRERNKQ AAARCRKRRV DQTNELTEEV
460 470 480 490 500
EQLEKRGESM RKEIEVLTNS KNQLEYLLAT HRATCQKIRS DMLSVVTCNG
510 520 530 540 550
LIAPAGLLSA GSSGSGASSH HNHNSNDSSN GTITGMDATL NSTGRSNSPL
560 570 580 590 600
DLKPAANIDS LLMHIKDEPL DGAIDSGSSL DQDGPPPSKR ITLPPMSTMP
610 620 630 640 650
HVHLSTILTP TGASSGSLQT PITSTAPGGF GSAFPVTSNG SSINNINSIG
660 670 680 690 700
NNMNSPTLNA HNKVPKERPN TLAFQRPLGQ MHLTMANNKA GGPTQIQGVP
710 720 730 740 750
IQTPSTGTFN FDSLMDGGTG LTPVSGPLVP NSSSTNKHPL ELPTPTAEPS

KLVSL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again