Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P21525-3 Isoform B of Transcription factor kayak, isoforms A/B/F n=56 Tax=Drosophilinae TaxID=43845 RepID=Isoform 3 of FOSLA_DROME MTLDSYNIFNDEYLFNMPLSPLPKVLGNFETGQSVLTLTTPTLTPTTTRNIEDTLGHLLS DTQTDRVAGCAGFAVPKVLPNAMGAIDALGMGIPTCVSSLPLQQTYDASLGQGSESEDSN ASYNDTQMNEEQDTTDTSSAHTDSTSYQAGHIMVGSVNGGGVNNFTNVLAAVSSSRGSAS VGSSNANTSNPPARRGGGRRPNRSTNMTPEEEQKRAVRRERNKQAAARCRKRRVDQTNEL TEEVEQLEKRRDSMRKEFEALTNSKKQLEYLLATHRSTCQKIRSDILSVATCNGLIAPDG LLSAGSSGSAASSHHNHNSNDSSNGTITGMDATLNSTGRSNSPLDLKPAANIDSLLLHIK DEPLDGAIDSGSSLDQDGPPPSKRITLPPMSTMPHVHLSTLITPTGASSGSLQTPITSTA PVGFGSAFPVTSNGSSINNINSIGNSMNSPTLNALNKVPKERPNTLAFQRPLGQMHLTMA NNKAGGPTQIQGVPIQTPSTGTFNFDSLMDGGTGLTPVSGPLVPNSSSTNKHPLELPTPT AEPSKLVSL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 56  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P21525-3Isoform 3 of FOSLA_DROMEB, gammaDrosophila melanogaster (Fruit fly)7227UniRef100_P21525-3
UniRef90_P21525-3
546Representative
B4HZE8FOSL_DROSETranscription factor kayakDrosophila sechellia (Fruit fly)7238UniRef100_B4HZE8
UniRef90_P21525-3
549
B4NBL5FOSL_DROWITranscription factor kayakDrosophila willistoni (Fruit fly)7260UniRef100_B4NBL5
UniRef90_B4NBL5
620
B4PPK2FOSL_DROYATranscription factor kayakDrosophila yakuba (Fruit fly)7245UniRef100_B4PPK2
UniRef90_B4PPK2
552
B4G652FOSL_DROPETranscription factor kayakDrosophila persimilis (Fruit fly)7234UniRef100_B4G652
UniRef90_B4G652
526
A8MPH9FOSLD_DROMETranscription factor kayak, isoforms D/sroDrosophila melanogaster (Fruit fly)7227UniRef100_A8MPH9
UniRef90_A8MPH9
722
A0A0B4LHU8A0A0B4LHU8_DROMEKayak, isoform GDrosophila melanogaster (Fruit fly)7227UniRef100_A0A0B4LHU8
UniRef90_P21525-3
646
C4JC86C4JC86_DROMELD16083pDrosophila melanogaster (Fruit fly)7227UniRef100_C4JC86
UniRef90_P21525-3
595
P21525-2Isoform 2 of FOSLA_DROMEA, betaDrosophila melanogaster (Fruit fly)7227UniRef100_C4JC86
UniRef90_P21525-3
595
A0A0P8XDZ4A0A0P8XDZ4_DROANUncharacterized protein, isoform BDrosophila ananassae (Fruit fly)7217UniRef100_A0A0P8XDZ4
UniRef90_A0A0P8XDZ4
705
A0A0Q9W128A0A0Q9W128_DROVIUncharacterized protein, isoform CDrosophila virilis (Fruit fly)7244UniRef100_A0A0Q9W128
UniRef90_A0A0Q9W128
615
A0A0Q9X1U8A0A0Q9X1U8_DROMOUncharacterized protein, isoform CDrosophila mojavensis (Fruit fly)7230UniRef100_A0A0Q9X1U8
UniRef90_A0A0Q9X1U8
601
A0A0B4UCB0A0A0B4UCB0_DROMOUncharacterized protein (Fragment)Drosophila mojavensis (Fruit fly)7230UniRef100_A0A0Q9X1U8
UniRef90_A0A0Q9X1U8
77
A0A0B4UDM0A0A0B4UDM0_DROARUncharacterized protein (Fragment)Drosophila arizonae (Fruit fly)7263UniRef100_A0A0Q9X1U8
UniRef90_A0A0Q9X1U8
77
A0A1W4UPH1A0A1W4UPH1_DROFCtranscription factor kayak isoform X3Drosophila ficusphila (Fruit fly)30025UniRef100_A0A1W4UPH1
UniRef90_A0A1W4UPH1
590
A0A1W4UPS0A0A1W4UPS0_DROFCtranscription factor kayak isoform X4Drosophila ficusphila (Fruit fly)30025UniRef100_A0A1W4UPS0
UniRef90_A0A1W4UPH1
539
A0A0R1E900A0A0R1E900_DROYAUncharacterized protein, isoform CDrosophila yakuba (Fruit fly)7245UniRef100_A0A0R1E900
UniRef90_B4PPK2
602
A0A0M5J0L9A0A0M5J0L9_DROBSKayDrosophila busckii (Fruit fly)30019UniRef100_A0A0M5J0L9
UniRef90_A0A0M5J0L9
530
A0A3B0JKR1A0A3B0JKR1_DROGUBlast:Transcription factor kayakDrosophila guanche (Fruit fly)7266UniRef100_A0A3B0JKR1
UniRef90_B4G652
549
A0A0R1E4N7A0A0R1E4N7_DROYAUncharacterized protein, isoform BDrosophila yakuba (Fruit fly)7245UniRef100_A0A0R1E4N7
UniRef90_A8MPH9
731Seed
UPI00078AECAFuncharacterized protein, isoform EDrosophila simulans (Fruit fly)7240UniRef100_UPI00078AECAF
UniRef90_P21525-3
598
UPI00078AE838uncharacterized protein, isoform CDrosophila simulans (Fruit fly)7240UniRef100_UPI00078AE838
UniRef90_P21525-3
549
UPI0007E88209transcription factor kayak isoform X4Drosophila elegans (Fruit fly)30023UniRef100_UPI0007E88209
UniRef90_UPI0007E87DBD
558
UPI0007E87DBDtranscription factor kayak isoform X3Drosophila elegans (Fruit fly)30023UniRef100_UPI0007E87DBD
UniRef90_UPI0007E87DBD
609
UPI0007E7CF5Dtranscription factor kayak isoform X3Drosophila rhopaloa (Fruit fly)1041015UniRef100_UPI0007E7CF5D
UniRef90_UPI0007E87DBD
579

Sequence

Representative sequenceiLengthMass (Da)Tools
P21525-3

Checksumi: E64F520D022F9621

FASTA54957,878
        10         20         30         40         50
MTLDSYNIFN DEYLFNMPLS PLPKVLGNFE TGQSVLTLTT PTLTPTTTRN
60 70 80 90 100
IEDTLGHLLS DTQTDRVAGC AGFAVPKVLP NAMGAIDALG MGIPTCVSSL
110 120 130 140 150
PLQQTYDASL GQGSESEDSN ASYNDTQMNE EQDTTDTSSA HTDSTSYQAG
160 170 180 190 200
HIMVGSVNGG GVNNFTNVLA AVSSSRGSAS VGSSNANTSN PPARRGGGRR
210 220 230 240 250
PNRSTNMTPE EEQKRAVRRE RNKQAAARCR KRRVDQTNEL TEEVEQLEKR
260 270 280 290 300
RDSMRKEFEA LTNSKKQLEY LLATHRSTCQ KIRSDILSVA TCNGLIAPDG
310 320 330 340 350
LLSAGSSGSA ASSHHNHNSN DSSNGTITGM DATLNSTGRS NSPLDLKPAA
360 370 380 390 400
NIDSLLLHIK DEPLDGAIDS GSSLDQDGPP PSKRITLPPM STMPHVHLST
410 420 430 440 450
LITPTGASSG SLQTPITSTA PVGFGSAFPV TSNGSSINNI NSIGNSMNSP
460 470 480 490 500
TLNALNKVPK ERPNTLAFQR PLGQMHLTMA NNKAGGPTQI QGVPIQTPST
510 520 530 540
GTFNFDSLMD GGTGLTPVSG PLVPNSSSTN KHPLELPTPT AEPSKLVSL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again