Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P21964 Catechol O-methyltransferase n=79 Tax=Eutheria TaxID=9347 RepID=COMT_HUMAN MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRIL NHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCG YSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKY DVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFE CTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Members

List component clusters with 100% or 90% identity.
1 to 25 of 79  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P21964COMT_HUMANCatechol O-methyltransferaseHomo sapiens (Human)9606UniRef100_P21964
UniRef90_P21964
271Representative
A0A140VJG8A0A140VJG8_HUMANTesticular tissue protein Li 42Homo sapiens (Human)9606UniRef100_P21964
UniRef90_P21964
271
Q7KZP0Q7KZP0_HUMANCatechol-O-methyltransferaseHomo sapiens (Human)9606UniRef100_P21964
UniRef90_P21964
84
A3F7Q5A3F7Q5_HUMANCatechol-O-methyltransferase isoform (Fragment)Homo sapiens (Human)9606UniRef100_P21964
UniRef90_P21964
13
E7EMS6E7EMS6_HUMANCatechol O-methyltransferase (Fragment)Homo sapiens (Human)9606UniRef100_P21964
UniRef90_P21964
223
A0A2K6LHY2A0A2K6LHY2_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6LHY2
UniRef90_P21964
304
A0A2K6RQP4A0A2K6RQP4_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RQP4
UniRef90_P21964
304
A0A2K6RQM6A0A2K6RQM6_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RQP4
UniRef90_P21964
221
G7N395G7N395_MACMUCatechol O-methyltransferaseMacaca mulatta (Rhesus macaque)9544UniRef100_G7N395
UniRef90_P21964
274
G7PH90G7PH90_MACFACatechol O-methyltransferaseMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7N395
UniRef90_P21964
274
A0A2H4UZ17A0A2H4UZ17_MACASCatechol O-methyltransferase (Fragment)Macaca assamensis assamensis1411634UniRef100_G7N395
UniRef90_P21964
19
A0A172C4C4A0A172C4C4_9PRIMCatechol-O-methyltransferase (Fragment)Macaca fuscata (Japanese macaque)9542UniRef100_G7N395
UniRef90_P21964
64
A0A096NUJ8A0A096NUJ8_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A096NUJ8
UniRef90_P21964
271
A0A2J8RBK6A0A2J8RBK6_PONABCOMT isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8RBK6
UniRef90_P21964
271
A0A2J8RBK7A0A2J8RBK7_PONABCOMT isoform 6 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8RBK6
UniRef90_P21964
223
A0A2J8RBK0A0A2J8RBK0_PONABCOMT isoform 9Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8RBK6
UniRef90_P21964
221
B8XPJ8B8XPJ8_HUMANMembrane bound catechol-O-methyltransferaseHomo sapiens (Human)9606UniRef100_B8XPJ8
UniRef90_P21964
271
B8XPJ7B8XPJ7_HUMANSoluble catechol-O-methyltransferaseHomo sapiens (Human)9606UniRef100_B8XPJ8
UniRef90_P21964
221
I2CT60I2CT60_MACMUCatechol O-methyltransferase isoform MB-COMTMacaca mulatta (Rhesus macaque)9544UniRef100_I2CT60
UniRef90_P21964
270
A0A0D9RHP5A0A0D9RHP5_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RHP5
UniRef90_P21964
270
F6QFW9F6QFW9_MACMUCatechol O-methyltransferase isoform MB-COMTMacaca mulatta (Rhesus macaque)9544UniRef100_F6QFW9
UniRef90_P21964
270
A0A2K5UPM3A0A2K5UPM3_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5UPM3
UniRef90_P21964
221
P21964-2Isoform 2 of COMT_HUMANSoluble, S-COMTHomo sapiens (Human)9606UniRef100_P21964-2
UniRef90_P21964
221
A0A2I3SYL3A0A2I3SYL3_PANTRCOMT isoform 9Pan troglodytes (Chimpanzee)9598UniRef100_P21964-2
UniRef90_P21964
221
A0A2R9A042A0A2R9A042_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_P21964-2
UniRef90_P21964
221

Sequence

Representative sequenceiLengthMass (Da)Tools
P21964

Checksumi: D2547A1C399AC758

FASTA27130,037
        10         20         30         40         50
MPEAPPLLLA AVLLGLVLLV VLLLLLRHWG WGLCLIGWNE FILQPIHNLL
60 70 80 90 100
MGDTKEQRIL NHVLQHAEPG NAQSVLEAID TYCEQKEWAM NVGDKKGKIV
110 120 130 140 150
DAVIQEHQPS VLLELGAYCG YSAVRMARLL SPGARLITIE INPDCAAITQ
160 170 180 190 200
RMVDFAGVKD KVTLVVGASQ DIIPQLKKKY DVDTLDMVFL DHWKDRYLPD
210 220 230 240 250
TLLLEECGLL RKGTVLLADN VICPGAPDFL AHVRGSSCFE CTHYQSFLEY
260 270
REVVDGLEKA IYKGPGSEAG P
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again