Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P24001 Interleukin-32 n=31 Tax=Simiiformes TaxID=314293 RepID=IL32_HUMAN MCFPKVLSDDMKKLKARMVMLLPTSAQGLGAWVSACDTEDTVGHLGPWRDKDPALWCQLC LSSQHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLE KERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKV VALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK

Members

List component clusters with 100% or 90% identity.
1 to 25 of 31  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P24001IL32_HUMANInterleukin-32Homo sapiens (Human)9606UniRef100_P24001
UniRef90_P24001
234Representative
F8VSD2F8VSD2_HUMANInterleukin-32 (Fragment)Homo sapiens (Human)9606UniRef100_P24001
UniRef90_P24001
225
C6GKH2C6GKH2_HUMANInterleukin-32 smallHomo sapiens (Human)9606UniRef100_P24001
UniRef90_P24001
80
A0A2J8LB80A0A2J8LB80_PANTRIL32 isoform 13Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LB80
UniRef90_P24001
234
A0A2J8LB86A0A2J8LB86_PANTRIL32 isoform 31 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LB80
UniRef90_P24001
225
A0A2R9CSP2A0A2R9CSP2_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9CSP2
UniRef90_P24001
234
A0A2I2Z5L2A0A2I2Z5L2_GORGOInterleukin 32Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2Z5L2
UniRef90_P24001
234
G3S3Y9G3S3Y9_GORGOInterleukin 32Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3S3Y9
UniRef90_P24001
225
F8VVN4F8VVN4_HUMANInterleukin-32Homo sapiens (Human)9606UniRef100_F8VVN4
UniRef90_P24001
225
A0A2I3SUF7A0A2I3SUF7_PANTRIL32 isoform 28Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3SUF7
UniRef90_P24001
225
A0A2R9CMY2A0A2R9CMY2_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9CMY2
UniRef90_P24001
225
A0A2I3TJ10A0A2I3TJ10_PANTRInterleukin 32Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3TJ10
UniRef90_P24001
224
G3RRF0G3RRF0_GORGOInterleukin 32Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RRF0
UniRef90_P24001
222
A0A2R9CKE3A0A2R9CKE3_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9CKE3
UniRef90_P24001
221
A0A2I2YE65A0A2I2YE65_GORGOInterleukin 32Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2YE65
UniRef90_P24001
221
E9PIV2E9PIV2_HUMANInterleukin-32Homo sapiens (Human)9606UniRef100_E9PIV2
UniRef90_P24001
221
A0A2I3RR19A0A2I3RR19_PANTRIL32 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RR19
UniRef90_P24001
221
F8W1V1F8W1V1_HUMANInterleukin-32Homo sapiens (Human)9606UniRef100_F8W1V1
UniRef90_P24001
212
A0A2J8LB82A0A2J8LB82_PANTRIL32 isoform 26Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LB82
UniRef90_P24001
212
A0A2I3SGE6A0A2I3SGE6_PANTRUncharacterized proteinPan troglodytes (Chimpanzee)9598UniRef100_A0A2I3SGE6
UniRef90_P24001
193
P24001-2Isoform 2 of IL32_HUMAN2, BetaHomo sapiens (Human)9606UniRef100_P24001-2
UniRef90_P24001
188
P24001-3Isoform 3 of IL32_HUMAN3, DeltaHomo sapiens (Human)9606UniRef100_P24001-2
UniRef90_P24001
178
A0A2J8S7X8A0A2J8S7X8_PONABIL32 isoform 38Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8S7X8
UniRef90_A0A2J8S7X8
136
A0A2J8S7U4A0A2J8S7U4_PONABIL32 isoform 11Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8S7U4
UniRef90_A0A2J8S7U4
214
A0A2J8S7U2A0A2J8S7U2_PONABIL32 isoform 13Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8S7U2
UniRef90_A0A2J8S7U4
214

Sequence

Representative sequenceiLengthMass (Da)Tools
P24001

Checksumi: 5F339FE2D348A761

FASTA23426,676
        10         20         30         40         50
MCFPKVLSDD MKKLKARMVM LLPTSAQGLG AWVSACDTED TVGHLGPWRD
60 70 80 90 100
KDPALWCQLC LSSQHQAIER FYDKMQNAES GRGQVMSSLA ELEDDFKEGY
110 120 130 140 150
LETVAAYYEE QHPELTPLLE KERDGLRCRG NRSPVPDVED PATEEPGESF
160 170 180 190 200
CDKVMRWFQA MLQRLQTWWH GVLAWVKEKV VALVHAVQAL WKQFQSFCCS
210 220 230
LSELFMSSFQ SYGAPRGDKE ELTPQKCSEP QSSK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again