Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P24001-4 Isoform 4 of Interleukin-32 n=11 Tax=Simiiformes TaxID=314293 RepID=Isoform 4 of IL32_HUMAN MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAA YYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKSYGAPRGDKEELT PQKCSEPQSSK

Members

List component clusters with 100% or 90% identity.
1 to 11 of 11  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P24001-4Isoform 4 of IL32_HUMAN4, AlphaHomo sapiens (Human)9606UniRef100_P24001-4
UniRef90_P24001-4
131Representative
A0A2R9CKG0A0A2R9CKG0_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9CKG0
UniRef90_P24001-4
131
A0A2I2ZSD0A0A2I2ZSD0_GORGOInterleukin 32Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2ZSD0
UniRef90_P24001-4
131
A0A2J8LB66A0A2J8LB66_PANTRIL32 isoform 10Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LB66
UniRef90_P24001-4
131
G3LU47G3LU47_HUMANInterleukin-32 etaHomo sapiens (Human)9606UniRef100_G3LU47
UniRef90_P24001-4
111
A0A2K5D9W6A0A2K5D9W6_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5D9W6
UniRef90_A0A2K5D9W6
116
A0A2J8S7W8A0A2J8S7W8_PONABIL32 isoform 32 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8S7W8
UniRef90_A0A2J8S7W8
131
E9PK07E9PK07_HUMANInterleukin-32 (Fragment)Homo sapiens (Human)9606UniRef100_E9PK07
UniRef90_E9PK07
131Seed
A0A2J8LB83A0A2J8LB83_PANTRIL32 isoform 32 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LB83
UniRef90_E9PK07
131
A0A2J8S7T7A0A2J8S7T7_PONABIL32 isoform 9Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8S7T7
UniRef90_A0A2J8S7T7
108
A0A2K5DA15A0A2K5DA15_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5DA15
UniRef90_A0A2K5DA15
131

Sequence

Representative sequenceiLengthMass (Da)Tools
P24001-4

Checksumi: A31708A3A25CFF6F

FASTA13114,909
        10         20         30         40         50
MCFPKVLSDD MKKLKARMHQ AIERFYDKMQ NAESGRGQVM SSLAELEDDF
60 70 80 90 100
KEGYLETVAA YYEEQHPELT PLLEKERDGL RCRGNRSPVP DVEDPATEEP
110 120 130
GESFCDKSYG APRGDKEELT PQKCSEPQSS K
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again