Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P24102 Peroxidase 22 n=198 Tax=Tracheophyta TaxID=58023 RepID=PER22_ARATH MGFSPSFSCSAIGALILGCLLLQASNSNAQLRPDFYFGTCPFVFDIIGNIIVDELQTDPR IAASLLRLHFHDCFVRGCDASILLDNSTSFRTEKDAAPNANSARGFNVIDRMKVALERAC PGRVSCADILTIASQISVLLSGGPWWPVPLGRRDSVEAFFALANTALPSPFFNLTQLKTA FADVGLNRTSDLVALSGGHTFGRAQCQFVTPRLYNFNGTNSPDPSLNPTYLVELRRLCPQ NGNGTVLVNFDVVTPDAFDSQYYTNLRNGKGLIQSDQELFSTPGADTIPLVNQYSSDMSV FFRAFIDAMIRMGNLRPLTGTQGEIRQNCRVVNPRIRVVENDDGVVSSI

Members

List component clusters with 100% or 90% identity.
1 to 25 of 198  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P24102PER22_ARATHPeroxidase 22Arabidopsis thaliana (Mouse-ear cress)3702UniRef100_P24102
UniRef90_P24102
349Representative
P17179PER2_ARMRUPeroxidase C2Armoracia rusticana (Horseradish) (Armoracia laphatifolia)3704UniRef100_P17179
UniRef90_P17179
347
A2YPX3PER2_ORYSIPeroxidase 2Oryza sativa subsp. indica (Rice)39946UniRef100_A2YPX3
UniRef90_A2YPX3
314
P19135PER2_CUCSAPeroxidase 2 (Fragment)Cucumis sativus (Cucumber)3659UniRef100_P19135
UniRef90_P19135
292
P59121PERE5_ARMRUPeroxidase E5Armoracia rusticana (Horseradish) (Armoracia laphatifolia)3704UniRef100_P59121
UniRef90_P59121
306
A0A384L8X8A0A384L8X8_ARATHPeroxidaseArabidopsis thaliana (Mouse-ear cress)3702UniRef100_P24102
UniRef90_P24102
349
Q0WLG9Q0WLG9_ARATHPeroxidaseArabidopsis thaliana (Mouse-ear cress)3702UniRef100_P24102
UniRef90_P24102
349
M0XRB9M0XRB9_HORVVPeroxidaseHordeum vulgare subsp. vulgare (Domesticated barley)112509UniRef100_M0XRB9
UniRef90_M0XRB9
337
A0A453IJK6A0A453IJK6_AEGTSPeroxidaseAegilops tauschii subsp. strangulata (Goatgrass)200361UniRef100_A0A453IJK6
UniRef90_M0XRB9
337
F2ECV7F2ECV7_HORVVPeroxidaseHordeum vulgare subsp. vulgare (Domesticated barley)112509UniRef100_F2ECV7
UniRef90_M0XRB9
336
A0A287PDN8A0A287PDN8_HORVVPeroxidaseHordeum vulgare subsp. vulgare (Domesticated barley)112509UniRef100_F2ECV7
UniRef90_M0XRB9
292
A0A3B6JJP2A0A3B6JJP2_WHEATPeroxidaseTriticum aestivum (Wheat)4565UniRef100_A0A3B6JJP2
UniRef90_M0XRB9
336
A0A453IKM2A0A453IKM2_AEGTSPeroxidaseAegilops tauschii subsp. strangulata (Goatgrass)200361UniRef100_A0A3B6JJP2
UniRef90_M0XRB9
307
M8BVA4M8BVA4_AEGTAPeroxidaseAegilops tauschii (Tausch's goatgrass) (Aegilops squarrosa)37682UniRef100_M8BVA4
UniRef90_M0XRB9
336
A0A3B6HSQ2A0A3B6HSQ2_WHEATPeroxidaseTriticum aestivum (Wheat)4565UniRef100_A0A3B6HSQ2
UniRef90_M0XRB9
336
A0A3B6IRL9A0A3B6IRL9_WHEATPeroxidaseTriticum aestivum (Wheat)4565UniRef100_A0A3B6IRL9
UniRef90_M0XRB9
336
A0A446SA80A0A446SA80_TRITDPeroxidaseTriticum turgidum subsp. durum (Durum wheat) (Triticum durum)4567UniRef100_A0A3B6IRL9
UniRef90_M0XRB9
336
A0A453IJY5A0A453IJY5_AEGTSPeroxidaseAegilops tauschii subsp. strangulata (Goatgrass)200361UniRef100_A0A453IJY5
UniRef90_M0XRB9
308
K4AC89K4AC89_SETITPeroxidaseSetaria italica (Foxtail millet) (Panicum italicum)4555UniRef100_K4AC89
UniRef90_K4AC89
338
A0A2T8I3L1A0A2T8I3L1_9POALPeroxidasePanicum hallii206008UniRef100_A0A2T8I3L1
UniRef90_K4AC89
391Seed
A0A2T7C983A0A2T7C983_9POALPeroxidasePanicum hallii var. hallii1504633UniRef100_A0A2T7C983
UniRef90_K4AC89
390
A0A1E5W137A0A1E5W137_9POALPeroxidaseDichanthelium oligosanthes888268UniRef100_A0A1E5W137
UniRef90_K4AC89
335
A0A317YK63A0A317YK63_MAIZEPeroxidaseZea mays (Maize)4577UniRef100_A0A317YK63
UniRef90_A0A1D6JVC3
335
A0A1D6JVC3A0A1D6JVC3_MAIZEPeroxidaseZea mays (Maize)4577UniRef100_A0A1D6JVC3
UniRef90_A0A1D6JVC3
335
Q7XHB3Q7XHB3_ORYSJPeroxidaseOryza sativa subsp. japonica (Rice)39947UniRef100_Q7XHB3
UniRef90_Q7XHB3
336

Sequence

Representative sequenceiLengthMass (Da)Tools
P24102

Checksumi: CC9A133616BDAD56

FASTA34938,108
        10         20         30         40         50
MGFSPSFSCS AIGALILGCL LLQASNSNAQ LRPDFYFGTC PFVFDIIGNI
60 70 80 90 100
IVDELQTDPR IAASLLRLHF HDCFVRGCDA SILLDNSTSF RTEKDAAPNA
110 120 130 140 150
NSARGFNVID RMKVALERAC PGRVSCADIL TIASQISVLL SGGPWWPVPL
160 170 180 190 200
GRRDSVEAFF ALANTALPSP FFNLTQLKTA FADVGLNRTS DLVALSGGHT
210 220 230 240 250
FGRAQCQFVT PRLYNFNGTN SPDPSLNPTY LVELRRLCPQ NGNGTVLVNF
260 270 280 290 300
DVVTPDAFDS QYYTNLRNGK GLIQSDQELF STPGADTIPL VNQYSSDMSV
310 320 330 340
FFRAFIDAMI RMGNLRPLTG TQGEIRQNCR VVNPRIRVVE NDDGVVSSI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again