Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P28720 Queuine tRNA-ribosyltransferase n=4689 RepID=TGT_ZYMMO MVEATAQETDRPRFSFSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKPETVR ATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEE GVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAK RSRDAFDSRKEQAENAALFGIQQGSVFENLRQQSADALAEIGFDGYAVGGLAVGEGQDEM FRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPI NIRNARFSEDLTPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQK IRDSISEGRFSQFAQDFRARYFARNS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 4,689  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P28720TGT_ZYMMOQueuine tRNA-ribosyltransferaseZymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)264203UniRef100_P28720
UniRef90_P28720
386Representative
Q5QVL2TGT_IDILOQueuine tRNA-ribosyltransferaseIdiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR)283942UniRef100_Q5QVL2
UniRef90_Q5QVL2
373
C1DE76TGT_AZOVDQueuine tRNA-ribosyltransferaseAzotobacter vinelandii (strain DJ / ATCC BAA-1303)322710UniRef100_C1DE76
UniRef90_C1DE76
371
Q5P720TGT_AROAEQueuine tRNA-ribosyltransferaseAromatoleum aromaticum (strain EbN1) (Azoarcus sp. (strain EbN1))76114UniRef100_Q5P720
UniRef90_Q5P720
370
Q28PC5TGT_JANSCQueuine tRNA-ribosyltransferaseJannaschia sp. (strain CCS1)290400UniRef100_Q28PC5
UniRef90_Q28PC5
376
Q9A7Y1TGT_CAUVCQueuine tRNA-ribosyltransferaseCaulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)190650UniRef100_Q9A7Y1
UniRef90_Q9A7Y1
371
Q0BVG4TGT_GRABCQueuine tRNA-ribosyltransferaseGranulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1)391165UniRef100_Q0BVG4
UniRef90_Q0BVG4
377
A8LRQ1TGT_DINSHQueuine tRNA-ribosyltransferaseDinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)398580UniRef100_A8LRQ1
UniRef90_A8LRQ1
376
Q3J2H4TGT_RHOS4Queuine tRNA-ribosyltransferaseRhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158)272943UniRef100_Q3J2H4
UniRef90_Q3J2H4
376
A3PJT9TGT_RHOS1Queuine tRNA-ribosyltransferaseRhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)349101UniRef100_A3PJT9
UniRef90_Q3J2H4
376
B7J4R9TGT_ACIF2Queuine tRNA-ribosyltransferaseAcidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) (Ferrobacillus ferrooxidans (strain ATCC 23270))243159UniRef100_B7J4R9
UniRef90_B7J4R9
371
B5EK08TGT_ACIF5Queuine tRNA-ribosyltransferaseAcidithiobacillus ferrooxidans (strain ATCC 53993) (Leptospirillum ferrooxidans (ATCC 53993))380394UniRef100_B7J4R9
UniRef90_B7J4R9
371
Q7UWK9TGT_RHOBAQueuine tRNA-ribosyltransferaseRhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)243090UniRef100_Q7UWK9
UniRef90_Q7UWK9
372
Q2G639TGT_NOVADQueuine tRNA-ribosyltransferaseNovosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)279238UniRef100_Q2G639
UniRef90_Q2G639
374
Q1GR26TGT_SPHALQueuine tRNA-ribosyltransferaseSphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) (Sphingomonas alaskensis)317655UniRef100_Q1GR26
UniRef90_Q1GR26
375
Q5LQ80TGT_RUEPOQueuine tRNA-ribosyltransferaseRuegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi)246200UniRef100_Q5LQ80
UniRef90_Q5LQ80
376
Q98M57TGT_RHILOQueuine tRNA-ribosyltransferaseMesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) (Mesorhizobium loti (strain MAFF 303099))266835UniRef100_Q98M57
UniRef90_Q98M57
376
A1TZN7TGT_MARHVQueuine tRNA-ribosyltransferaseMarinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)351348UniRef100_A1TZN7
UniRef90_A1TZN7
373
A9HBJ2TGT_GLUDAQueuine tRNA-ribosyltransferaseGluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5)272568UniRef100_A9HBJ2
UniRef90_A9HBJ2
387
A0A2R4RR68A0A2R4RR68_ZYMMBQueuine tRNA-ribosyltransferaseZymomonas mobilis subsp. mobilis120045UniRef100_P28720
UniRef90_P28720
386
A0A2R4S325A0A2R4S325_ZYMMOQueuine tRNA-ribosyltransferaseZymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)264203UniRef100_P28720
UniRef90_P28720
386
A0A2R9NVA6A0A2R9NVA6_ZYMMBQueuine tRNA-ribosyltransferaseZymomonas mobilis subsp. mobilis NRRL B-125261194424UniRef100_A0A2R9NVA6
UniRef90_P28720
395
A0A0H3G6L1A0A0H3G6L1_ZYMMAQueuine tRNA-ribosyltransferaseZymomonas mobilis subsp. mobilis (strain ATCC 10988 / DSM 424 / LMG 404 / NCIMB 8938 / NRRL B-806 / ZM1)555217UniRef100_A0A0H3G6L1
UniRef90_P28720
395
A0A1Y2QT24A0A1Y2QT24_9SPHNQueuine tRNA-ribosyltransferaseSphingomonas sp. IBVSS11985171UniRef100_A0A1Y2QT24
UniRef90_A0A1Y2QT24
381
A0A255Y8R0A0A255Y8R0_9SPHNQueuine tRNA-ribosyltransferaseSandarakinorhabdus cyanobacteriorum1981098UniRef100_A0A255Y8R0
UniRef90_A0A1Y2QT24
381

Sequence

Representative sequenceiLengthMass (Da)Tools
P28720

Checksumi: 26754E08600BD941

FASTA38642,843
        10         20         30         40         50
MVEATAQETD RPRFSFSIAA REGKARTGTI EMKRGVIRTP AFMPVGTAAT
60 70 80 90 100
VKALKPETVR ATGADIILGN TYHLMLRPGA ERIAKLGGLH SFMGWDRPIL
110 120 130 140 150
TDSGGYQVMS LSSLTKQSEE GVTFKSHLDG SRHMLSPERS IEIQHLLGSD
160 170 180 190 200
IVMAFDECTP YPATPSRAAS SMERSMRWAK RSRDAFDSRK EQAENAALFG
210 220 230 240 250
IQQGSVFENL RQQSADALAE IGFDGYAVGG LAVGEGQDEM FRVLDFSVPM
260 270 280 290 300
LPDDKPHYLM GVGKPDDIVG AVERGIDMFD CVLPTRSGRN GQAFTWDGPI
310 320 330 340 350
NIRNARFSED LTPLDSECHC AVCQKWSRAY IHHLIRAGEI LGAMLMTEHN
360 370 380
IAFYQQLMQK IRDSISEGRF SQFAQDFRAR YFARNS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again