Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P34218 Histone acetyltransferase SAS3 n=11 Tax=Saccharomyces TaxID=4930 RepID=SAS3_YEAST MSLTANDESPKPKKNALLKNLEIDDLIHSQFVRSDTNGHRTTRRLFNSDASISHRIRGSV RSDKGLNKIKKGLISQQSKLASENSSQNIVNRDNKMGAVSFPIIEPNIEVSEELKVRIKY DSIKFFNFERLISKSSVIAPLVNKNITSSGPLIGFQRRVNRLKQTWDLATENMEYPYSSD NTPFRDNDSWQWYVPYGGTIKKMKDFSTKRTLPTWEDKIKFLTFLENSKSATYINGNVSL CNHNETDQENEDRKKRKGKVPRIKNKVWFSQIEYIVLRNYEIKPWYTSPFPEHINQNKMV FICEFCLKYMTSRYTFYRHQLKCLTFKPPGNEIYRDGKLSVWEIDGRENVLYCQNLCLLA KCFINSKTLYYDVEPFIFYILTEREDTENHPYQNAAKFHFVGYFSKEKFNSNDYNLSCIL TLPIYQRKGYGQFLMEFSYLLSRKESKFGTPEKPLSDLGLLTYRTFWKIKCAEVLLKLRD SARRRSNNKNEDTFQQVSLNDIAKLTGMIPTDVVFGLEQLQVLYRHKTRSLSSLDDFNYI IKIDSWNRIENIYKTWSSKNYPRVKYDKLLWEPIILGPSFGINGMMNLEPTALADEALTN ETMAPVISNNTHIENYNNSRAHNKRRRRRRRSSEHKTSKLHVNNIIEPEVPATDFFEDTV SSLTEYMCDYKNTNNDRLIYQAEKRVLESIHDRKGIPRSKFSTETHWELCFTIKNSETPL GNHAARRNDTGISSLEQDEVENDVDTELYVGENAKEDEDEDEDFTLDDDIEDEQISEEND EEEDTYEEDSDDDEDGKRKGQEQDENDIESHIRKERVRKRRKITLIEDDEE

Members

List component clusters with 100% or 90% identity.
1 to 11 of 11  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P34218SAS3_YEASTHistone acetyltransferase SAS3Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)559292UniRef100_P34218
UniRef90_P34218
831Representative
C8Z3P6C8Z3P6_YEAS8Histone acetyltransferaseSaccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) (Baker's yeast)643680UniRef100_C8Z3P6
UniRef90_P34218
832
B3LNI9B3LNI9_YEAS1Histone acetyltransferaseSaccharomyces cerevisiae (strain RM11-1a) (Baker's yeast)285006UniRef100_B3LNI9
UniRef90_P34218
832
A0A0L8VW19A0A0L8VW19_9SACHHistone acetyltransferaseSaccharomyces sp. 'boulardii'252598UniRef100_A0A0L8VW19
UniRef90_P34218
832
A6ZKP6A6ZKP6_YEAS7Histone acetyltransferaseSaccharomyces cerevisiae (strain YJM789) (Baker's yeast)307796UniRef100_A0A0L8VW19
UniRef90_P34218
832
B5VDT2B5VDT2_YEAS6Histone acetyltransferase (Fragment)Saccharomyces cerevisiae (strain AWRI1631) (Baker's yeast)545124UniRef100_A0A0L8VW19
UniRef90_P34218
555
C7GNB2C7GNB2_YEAS2Histone acetyltransferaseSaccharomyces cerevisiae (strain JAY291) (Baker's yeast)574961UniRef100_C7GNB2
UniRef90_P34218
832
G2W8V6G2W8V6_YEASKHistone acetyltransferaseSaccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) (Baker's yeast)721032UniRef100_G2W8V6
UniRef90_P34218
831
N1P9P9N1P9P9_YEASCHistone acetyltransferaseSaccharomyces cerevisiae (strain CEN.PK113-7D) (Baker's yeast)889517UniRef100_N1P9P9
UniRef90_P34218
831
J6EH24J6EH24_SACK1Histone acetyltransferaseSaccharomyces kudriavzevii (strain ATCC MYA-4449 / AS 2.2408 / CBS 8840 / NBRC 1802 / NCYC 2889) (Yeast)226230UniRef100_J6EH24
UniRef90_J6EH24
846Seed
A0A0L8RNQ9A0A0L8RNQ9_SACEUHistone acetyltransferaseSaccharomyces eubayanus (Yeast)1080349UniRef100_A0A0L8RNQ9
UniRef90_A0A0L8RNQ9
841

Sequence

Representative sequenceiLengthMass (Da)Tools
P34218

Checksumi: ACF5B1B225CB4A71

FASTA83197,582
        10         20         30         40         50
MSLTANDESP KPKKNALLKN LEIDDLIHSQ FVRSDTNGHR TTRRLFNSDA
60 70 80 90 100
SISHRIRGSV RSDKGLNKIK KGLISQQSKL ASENSSQNIV NRDNKMGAVS
110 120 130 140 150
FPIIEPNIEV SEELKVRIKY DSIKFFNFER LISKSSVIAP LVNKNITSSG
160 170 180 190 200
PLIGFQRRVN RLKQTWDLAT ENMEYPYSSD NTPFRDNDSW QWYVPYGGTI
210 220 230 240 250
KKMKDFSTKR TLPTWEDKIK FLTFLENSKS ATYINGNVSL CNHNETDQEN
260 270 280 290 300
EDRKKRKGKV PRIKNKVWFS QIEYIVLRNY EIKPWYTSPF PEHINQNKMV
310 320 330 340 350
FICEFCLKYM TSRYTFYRHQ LKCLTFKPPG NEIYRDGKLS VWEIDGRENV
360 370 380 390 400
LYCQNLCLLA KCFINSKTLY YDVEPFIFYI LTEREDTENH PYQNAAKFHF
410 420 430 440 450
VGYFSKEKFN SNDYNLSCIL TLPIYQRKGY GQFLMEFSYL LSRKESKFGT
460 470 480 490 500
PEKPLSDLGL LTYRTFWKIK CAEVLLKLRD SARRRSNNKN EDTFQQVSLN
510 520 530 540 550
DIAKLTGMIP TDVVFGLEQL QVLYRHKTRS LSSLDDFNYI IKIDSWNRIE
560 570 580 590 600
NIYKTWSSKN YPRVKYDKLL WEPIILGPSF GINGMMNLEP TALADEALTN
610 620 630 640 650
ETMAPVISNN THIENYNNSR AHNKRRRRRR RSSEHKTSKL HVNNIIEPEV
660 670 680 690 700
PATDFFEDTV SSLTEYMCDY KNTNNDRLIY QAEKRVLESI HDRKGIPRSK
710 720 730 740 750
FSTETHWELC FTIKNSETPL GNHAARRNDT GISSLEQDEV ENDVDTELYV
760 770 780 790 800
GENAKEDEDE DEDFTLDDDI EDEQISEEND EEEDTYEEDS DDDEDGKRKG
810 820 830
QEQDENDIES HIRKERVRKR RKITLIEDDE E
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again