Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P40617 ADP-ribosylation factor-like protein 4A n=273 Tax=Bilateria TaxID=33213 RepID=ARL4A_HUMAN MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIK VTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITR ISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLE KLHDMIIKRRKMLRQQKKKR

Members

List component clusters with 100% or 90% identity.
1 to 25 of 273  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P40617ARL4A_HUMANADP-ribosylation factor-like protein 4AHomo sapiens (Human)9606UniRef100_P40617
UniRef90_P40617
200Representative
Q99PE9ARL4D_MOUSEADP-ribosylation factor-like protein 4DMus musculus (Mouse)10090UniRef100_Q99PE9
UniRef90_P49703
201
P49703ARL4D_HUMANADP-ribosylation factor-like protein 4DHomo sapiens (Human)9606UniRef100_P49703
UniRef90_P49703
201
Q5REU3ARL4D_PONABADP-ribosylation factor-like protein 4DPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P49703
UniRef90_P49703
201
Q0VC18ARL4D_BOVINADP-ribosylation factor-like protein 4DBos taurus (Bovine)9913UniRef100_Q0VC18
UniRef90_P49703
200
A0A2Y9QEM5A0A2Y9QEM5_TRIMAADP-ribosylation factor-like protein 4A isoform X1Trichechus manatus latirostris (Florida manatee)127582UniRef100_P40617
UniRef90_P40617
232
A0A024R9Z2A0A024R9Z2_HUMANADP-ribosylation factor-like 4A, isoform CRA_aHomo sapiens (Human)9606UniRef100_P40617
UniRef90_P40617
200
A0A2Y9QLM4A0A2Y9QLM4_TRIMAADP-ribosylation factor-like protein 4A isoform X2Trichechus manatus latirostris (Florida manatee)127582UniRef100_P40617
UniRef90_P40617
200
H2QZJ8H2QZJ8_PANTRADP-ribosylation factor-like 4APan troglodytes (Chimpanzee)9598UniRef100_P40617
UniRef90_P40617
200
G7MLS5G7MLS5_MACMUADP-ribosylation factor-like protein 4AMacaca mulatta (Rhesus macaque)9544UniRef100_P40617
UniRef90_P40617
200
A0A2K5L3M6A0A2K5L3M6_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_P40617
UniRef90_P40617
200
A0A096N8E3A0A096N8E3_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_P40617
UniRef90_P40617
200
A0A2K5XET7A0A2K5XET7_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_P40617
UniRef90_P40617
200
G1S2M1G1S2M1_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_P40617
UniRef90_P40617
200
A0A2I2YGI0A0A2I2YGI0_GORGOUncharacterized proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_P40617
UniRef90_P40617
200
A0A2K5XSK7A0A2K5XSK7_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5XSK7
UniRef90_P40617
216
A0A2I2YI38A0A2I2YI38_GORGOUncharacterized proteinGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2YI38
UniRef90_P40617
212
A0A402G655A0A402G655_9SAURUncharacterized protein (Fragment)Paroedura picta143630UniRef100_A0A402G655
UniRef90_A0A402G655
252
A0A2U9CAY4A0A2U9CAY4_SCOMXADP-ribosylation factor-like protein 4CScophthalmus maximus (Turbot) (Psetta maxima)52904UniRef100_A0A2U9CAY4
UniRef90_A0A2U9CAY4
192
A0A3P8ULP9A0A3P8ULP9_CYNSEADP-ribosylation factor-like 4CbCynoglossus semilaevis (Tongue sole)244447UniRef100_A0A3P8ULP9
UniRef90_A0A3P8ULP9
216
A0A2K5VRI8A0A2K5VRI8_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5VRI8
UniRef90_A0A2K5VRI8
177
A0A0N8JVS4A0A0N8JVS4_SCLFOADP-ribosylation factor-like protein 4D-likeScleropages formosus (Asian bonytongue) (Osteoglossum formosum)113540UniRef100_A0A0N8JVS4
UniRef90_A0A0N8JVS4
228
A0A3B3R877A0A3B3R877_9TELEUncharacterized proteinParamormyrops kingsleyae1676925UniRef100_A0A3B3R877
UniRef90_A0A0N8JVS4
200
A0A1U7TS30A0A1U7TS30_TARSYADP-ribosylation factor-like protein 4ATarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7TS30
UniRef90_A0A1U7TS30
140
A0A2J8WJ91A0A2J8WJ91_PONABARL4A isoform 6 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A1U7TS30
UniRef90_A0A1U7TS30
51

Sequence

Representative sequenceiLengthMass (Da)Tools
P40617

Checksumi: 8D93A8C003BD16CF

FASTA20022,615
        10         20         30         40         50
MGNGLSDQTS ILSNLPSFQS FHIVILGLDC AGKTTVLYRL QFNEFVNTVP
60 70 80 90 100
TKGFNTEKIK VTLGNSKTVT FHFWDVGGQE KLRPLWKSYT RCTDGIVFVV
110 120 130 140 150
DSVDVERMEE AKTELHKITR ISENQGVPVL IVANKQDLRN SLSLSEIEKL
160 170 180 190 200
LAMGELSSST PWHLQPTCAI IGDGLKEGLE KLHDMIIKRR KMLRQQKKKR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again