Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P40617 ADP-ribosylation factor-like protein 4A n=189 Tax=Bilateria TaxID=33213 RepID=ARL4A_HUMAN MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIK VTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITR ISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLE KLHDMIIKRRKMLRQQKKKR

Members

List component clusters with 100% or 90% identity.
26 to 50 of 189  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A1A8C3M0A0A1A8C3M0_9TELEADP-ribosylation factor-like 4D (Fragment)Nothobranchius kadleci1051664UniRef100_A0A1A8JYS4
UniRef90_I3KZJ3
224
A0A3P9P5S3A0A3P9P5S3_POEREADP-ribosylation factor-like 4DPoecilia reticulata (Guppy) (Acanthophacelus reticulatus)8081UniRef100_A0A3P9P5S3
UniRef90_I3KZJ3
201
A0A3B5LAS3A0A3B5LAS3_9TELEADP-ribosylation factor-like 4DXiphophorus couchianus (Monterrey platyfish)32473UniRef100_A0A3B5LAS3
UniRef90_I3KZJ3
201
A0A1A8QGY9A0A1A8QGY9_9TELEADP-ribosylation factor-like 4DNothobranchius rachovii (bluefin notho)451742UniRef100_A0A1A8QGY9
UniRef90_I3KZJ3
201
A0A1A8L335A0A1A8L335_9TELEADP-ribosylation factor-like 4D (Fragment)Nothobranchius pienaari704102UniRef100_A0A1A8QGY9
UniRef90_I3KZJ3
224
A0A1A8V1Q3A0A1A8V1Q3_NOTFUADP-ribosylation factor-like 4D (Fragment)Nothobranchius furzeri (Turquoise killifish)105023UniRef100_A0A1A8QGY9
UniRef90_I3KZJ3
224
A0A1A8H1B4A0A1A8H1B4_9TELEADP-ribosylation factor-like 4DNothobranchius korthausae1143690UniRef100_A0A1A8H1B4
UniRef90_I3KZJ3
201
A0A3B4U8K9A0A3B4U8K9_SERDUADP-ribosylation factor-like 4DSeriola dumerili (Greater amberjack) (Caranx dumerili)41447UniRef100_A0A3B4U8K9
UniRef90_I3KZJ3
201
A0A3B4WT15A0A3B4WT15_SERLLADP-ribosylation factor-like 4DSeriola lalandi dorsalis1841481UniRef100_A0A3B4U8K9
UniRef90_I3KZJ3
201
A0A1A7XZF4A0A1A7XZF4_9TELEADP-ribosylation factor-like 4DIconisemion striatum60296UniRef100_A0A1A7XZF4
UniRef90_I3KZJ3
201
M4AZM9M4AZM9_XIPMAADP-ribosylation factor-like 4DXiphophorus maculatus (Southern platyfish) (Platypoecilus maculatus)8083UniRef100_M4AZM9
UniRef90_I3KZJ3
201
G3NHQ9G3NHQ9_GASACADP-ribosylation factor-like 4DGasterosteus aculeatus (Three-spined stickleback)69293UniRef100_G3NHQ9
UniRef90_I3KZJ3
201
A0A3Q0S9L2A0A3Q0S9L2_AMPCIADP-ribosylation factor-like 4DAmphilophus citrinellus (Midas cichlid) (Cichlasoma citrinellum)61819UniRef100_A0A3Q0S9L2
UniRef90_I3KZJ3
201
A0A0S7H3F8A0A0S7H3F8_9TELEARL4DPoeciliopsis prolifica (blackstripe livebearer)188132UniRef100_A0A0S7H3F8
UniRef90_I3KZJ3
201
A0A087YRC0A0A087YRC0_POEFOADP-ribosylation factor-like 4DPoecilia formosa (Amazon molly) (Limia formosa)48698UniRef100_A0A087YRC0
UniRef90_I3KZJ3
201
A0A3B3URG9A0A3B3URG9_9TELEADP-ribosylation factor-like 4DPoecilia latipinna (sailfin molly)48699UniRef100_A0A087YRC0
UniRef90_I3KZJ3
201
A0A3B3XVQ6A0A3B3XVQ6_9TELEADP-ribosylation factor-like 4DPoecilia mexicana48701UniRef100_A0A087YRC0
UniRef90_I3KZJ3
201
A0A0S7H3G7A0A0S7H3G7_9TELEARL4D (Fragment)Poeciliopsis prolifica (blackstripe livebearer)188132UniRef100_A0A087YRC0
UniRef90_I3KZJ3
102
I3KZJ3I3KZJ3_ORENIADP-ribosylation factor-like 4DOreochromis niloticus (Nile tilapia) (Tilapia nilotica)8128UniRef100_I3KZJ3
UniRef90_I3KZJ3
201
A0A3Q2WQG6A0A3Q2WQG6_HAPBUADP-ribosylation factor-like 4DHaplochromis burtoni (Burton's mouthbrooder) (Chromis burtoni)8153UniRef100_A0A3Q2WQG6
UniRef90_I3KZJ3
201
A0A484C1R2A0A484C1R2_PERFVUncharacterized proteinPerca flavescens (American yellow perch) (Morone flavescens)8167UniRef100_A0A484C1R2
UniRef90_I3KZJ3
201
A0A3B4EU95A0A3B4EU95_9CICHADP-ribosylation factor-like 4DPundamilia nyererei303518UniRef100_A0A3B4EU95
UniRef90_I3KZJ3
201
A0A3P9BIP9A0A3P9BIP9_9CICHADP-ribosylation factor-like 4DMaylandia zebra (zebra mbuna)106582UniRef100_A0A3B4EU95
UniRef90_I3KZJ3
201
A0A3P8R5Y3A0A3P8R5Y3_ASTCAADP-ribosylation factor-like 4DAstatotilapia calliptera (Eastern happy) (Chromis callipterus)8154UniRef100_A0A3B4EU95
UniRef90_I3KZJ3
201
M1EDL6M1EDL6_MUSPFADP-ribosylation factor-like protein 4C-like protein (Fragment)Mustela putorius furo (European domestic ferret) (Mustela furo)9669UniRef100_M1EDL6
UniRef90_H2QJN7
207

Sequence

Representative sequenceiLengthMass (Da)Tools
P40617

Checksumi: 8D93A8C003BD16CF

FASTA20022,615
        10         20         30         40         50
MGNGLSDQTS ILSNLPSFQS FHIVILGLDC AGKTTVLYRL QFNEFVNTVP
60 70 80 90 100
TKGFNTEKIK VTLGNSKTVT FHFWDVGGQE KLRPLWKSYT RCTDGIVFVV
110 120 130 140 150
DSVDVERMEE AKTELHKITR ISENQGVPVL IVANKQDLRN SLSLSEIEKL
160 170 180 190 200
LAMGELSSST PWHLQPTCAI IGDGLKEGLE KLHDMIIKRR KMLRQQKKKR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again