Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P40617 ADP-ribosylation factor-like protein 4A n=189 Tax=Bilateria TaxID=33213 RepID=ARL4A_HUMAN MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIK VTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITR ISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLE KLHDMIIKRRKMLRQQKKKR

Members

List component clusters with 100% or 90% identity.
1 to 25 of 189  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
A0A2J8WJ91A0A2J8WJ91_PONABARL4A isoform 6 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A1U7TS30
UniRef90_A0A1U7TS30
51
A0A1A8DS06A0A1A8DS06_9TELEADP-ribosylation factor-like 4Cb (Fragment)Nothobranchius kadleci1051664UniRef100_A0A1A8UE61
UniRef90_A0A1S3MRJ4
80
A0A0S7H3G7A0A0S7H3G7_9TELEARL4D (Fragment)Poeciliopsis prolifica (blackstripe livebearer)188132UniRef100_A0A087YRC0
UniRef90_I3KZJ3
102
A0A1U7TS30A0A1U7TS30_TARSYADP-ribosylation factor-like protein 4ATarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7TS30
UniRef90_A0A1U7TS30
140
A0A093HZD6A0A093HZD6_STRCAADP-ribosylation factor-like 4C (Fragment)Struthio camelus australis441894UniRef100_A0A099ZPF1
UniRef90_H2QJN7
163
A0A093NL32A0A093NL32_PYGADADP-ribosylation factor-like 4C (Fragment)Pygoscelis adeliae (Adelie penguin)9238UniRef100_A0A087RDD3
UniRef90_H2QJN7
165
A0A099ZPF1A0A099ZPF1_TINGUADP-ribosylation factor-like 4C (Fragment)Tinamus guttatus (White-throated tinamou)94827UniRef100_A0A099ZPF1
UniRef90_H2QJN7
172
UPI000E1BC182ADP-ribosylation factor-like protein 4CNothoprocta perdicaria (Chilean tinamou) (Crypturus perdicarius)30464UniRef100_A0A099ZPF1
UniRef90_H2QJN7
175
UPI000CD5FE15ADP-ribosylation factor-like protein 4CParamormyrops kingsleyae1676925UniRef100_A0A3B3QAH5
UniRef90_A0A1S3MRJ4
175
A0A2D4JJU4A0A2D4JJU4_MICLEUncharacterized protein (Fragment)Micrurus lemniscatus lemniscatus129467UniRef100_A0A2D4N6H8
UniRef90_H2QJN7
176
A0A2K5VRI8A0A2K5VRI8_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5VRI8
UniRef90_A0A2K5VRI8
177
Q3TE09Q3TE09_MOUSEUncharacterized protein (Fragment)Mus musculus (Mouse)10090UniRef100_Q3TE09
UniRef90_H2QJN7
180
W5QJB6W5QJB6_SHEEPUncharacterized proteinOvis aries (Sheep)9940UniRef100_W5QJB6
UniRef90_H2QJN7
187
A0A091Q666A0A091Q666_LEPDCADP-ribosylation factor-like 4CLeptosomus discolor (Madagascar cuckoo roller) (Cuculus discolor)188344UniRef100_A0A091Q666
UniRef90_H2QJN7
190
A0A5F4CIF7A0A5F4CIF7_CANLFADP ribosylation factor like GTPase 4CCanis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_A0A5F4CIF7
UniRef90_A0A1S3MRJ4
190
Q6DJP6Q6DJP6_XENLALOC443720 protein (Fragment)Xenopus laevis (African clawed frog)8355UniRef100_Q6DJP6
UniRef90_H2QJN7
191
A0A2U9CAY4A0A2U9CAY4_SCOMXADP-ribosylation factor-like protein 4CScophthalmus maximus (Turbot) (Psetta maxima)52904UniRef100_A0A2U9CAY4
UniRef90_A0A2U9CAY4
192
A0A1U7SC18A0A1U7SC18_ALLSIADP-ribosylation factor-like protein 4CAlligator sinensis (Chinese alligator)38654UniRef100_A0A151N9L9
UniRef90_H2QJN7
192
A0A091I2Z1A0A091I2Z1_CALANADP-ribosylation factor-like 4CCalypte anna (Anna's hummingbird) (Archilochus anna)9244UniRef100_A0A091I2Z1
UniRef90_H2QJN7
192
A0A087RDD3A0A087RDD3_APTFOADP-ribosylation factor-like 4CAptenodytes forsteri (Emperor penguin)9233UniRef100_A0A087RDD3
UniRef90_H2QJN7
192
A0A2D4N6H8A0A2D4N6H8_9SAURUncharacterized proteinMicrurus spixii (Amazon coral snake)129469UniRef100_A0A2D4N6H8
UniRef90_H2QJN7
192
H9YVR2H9YVR2_MACMUADP-ribosylation factor-like protein 4CMacaca mulatta (Rhesus macaque)9544UniRef100_H9YVR2
UniRef90_H2QJN7
192
R7VP11R7VP11_COLLIADP-ribosylation factor-like 4CColumba livia (Rock dove)8932UniRef100_R7VP11
UniRef90_H2QJN7
192
A0A091G1P3A0A091G1P3_9AVESADP-ribosylation factor-like 4CCuculus canorus (common cuckoo)55661UniRef100_A0A091G1P3
UniRef90_H2QJN7
192
A0A452HT97A0A452HT97_9SAURADP ribosylation factor like GTPase 4CGopherus agassizii (Agassiz's desert tortoise)38772UniRef100_A0A452HT97
UniRef90_H2QJN7
192

Sequence

Representative sequenceiLengthMass (Da)Tools
P40617

Checksumi: 8D93A8C003BD16CF

FASTA20022,615
        10         20         30         40         50
MGNGLSDQTS ILSNLPSFQS FHIVILGLDC AGKTTVLYRL QFNEFVNTVP
60 70 80 90 100
TKGFNTEKIK VTLGNSKTVT FHFWDVGGQE KLRPLWKSYT RCTDGIVFVV
110 120 130 140 150
DSVDVERMEE AKTELHKITR ISENQGVPVL IVANKQDLRN SLSLSEIEKL
160 170 180 190 200
LAMGELSSST PWHLQPTCAI IGDGLKEGLE KLHDMIIKRR KMLRQQKKKR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again