Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P42765 3-ketoacyl-CoA thiolase, mitochondrial n=562 RepID=THIM_HUMAN MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVL QSSSDAIYLARHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTE SMSQAPYCVRNVRFGTKLGSDIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECD KYALQSQQRWKAANDAGYFNDEMAPIEVKTKKGKQTMQVDEHARPQTTLEQLQKLPPVFK KDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIVGYFVSGCDPSIMGIGPVPAI SGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIALGHPLGGSGSR ITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA

Members

List component clusters with 100% or 90% identity.
1 to 25 of 562  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P42765THIM_HUMAN3-ketoacyl-CoA thiolase, mitochondrialHomo sapiens (Human)9606UniRef100_P42765
UniRef90_P42765
397Representative
Q5RES5THIM_PONAB3-ketoacyl-CoA thiolase, mitochondrialPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5RES5
UniRef90_P42765
397
P13437THIM_RAT3-ketoacyl-CoA thiolase, mitochondrialRattus norvegicus (Rat)10116UniRef100_P13437
UniRef90_P13437
397
Q8BWT1THIM_MOUSE3-ketoacyl-CoA thiolase, mitochondrialMus musculus (Mouse)10090UniRef100_Q8BWT1
UniRef90_P13437
397
K7EME0K7EME0_HUMAN3-ketoacyl-CoA thiolase, mitochondrialHomo sapiens (Human)9606UniRef100_P42765
UniRef90_P42765
342
K7ER88K7ER88_HUMAN3-ketoacyl-CoA thiolase, mitochondrial (Fragment)Homo sapiens (Human)9606UniRef100_P42765
UniRef90_P42765
72
A0A2J8UED3A0A2J8UED3_PONABACAA2 isoform 7 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P42765
UniRef90_P42765
72
K7EJB1K7EJB1_HUMAN3-ketoacyl-CoA thiolase, mitochondrial (Fragment)Homo sapiens (Human)9606UniRef100_P42765
UniRef90_P42765
84
K7EJ68K7EJ68_HUMAN3-ketoacyl-CoA thiolase, mitochondrial (Fragment)Homo sapiens (Human)9606UniRef100_P42765
UniRef90_P42765
124
A0A2K5Z6W1A0A2K5Z6W1_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5Z6W1
UniRef90_P42765
402
A0A2I3MPY0A0A2I3MPY0_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3MPY0
UniRef90_P42765
402
A0A2I3MV66A0A2I3MV66_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3MV66
UniRef90_P42765
401
A0A0D9RZN3A0A0D9RZN3_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RZN3
UniRef90_P42765
397
A0A2R8MAM4A0A2R8MAM4_CALJAAcetyl-CoA acyltransferase 2Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A2R8MAM4
UniRef90_P42765
397
A0A2K5LPT1A0A2K5LPT1_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5LPT1
UniRef90_P42765
397
A0A2I3LDK7A0A2I3LDK7_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3LDK7
UniRef90_P42765
397
A0A2K6TZZ1A0A2K6TZZ1_SAIBBAcetyl-CoA acyltransferase 2Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6TZZ1
UniRef90_P42765
397
B3KNP8B3KNP8_HUMANcDNA FLJ30111 fis, clone BNGH42000360, highly similar to 3-ketoacyl-CoA thiolase, mitochondrialHomo sapiens (Human)9606UniRef100_B3KNP8
UniRef90_P42765
397
G3RA00G3RA00_GORGOAcetyl-CoA acyltransferase 2Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RA00
UniRef90_P42765
397
A0A2K5QQ81A0A2K5QQ81_CEBCAUncharacterized proteinCebus capucinus imitator1737458UniRef100_A0A2K5QQ81
UniRef90_P42765
397
U3FQH9U3FQH9_CALJA3-ketoacyl-CoA thiolase, mitochondrialCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3FQH9
UniRef90_P42765
397
B2RB23B2RB23_HUMANcDNA, FLJ95265, highly similar to Homo sapiens acetyl-Coenzyme A acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase) (ACAA2), nuclear gene encoding mitochondrial protein, mRNAHomo sapiens (Human)9606UniRef100_B2RB23
UniRef90_P42765
397
A0A2K6TZV8A0A2K6TZV8_SAIBBAcetyl-CoA acyltransferase 2Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6TZV8
UniRef90_P42765
397
A0A2K6PVK6A0A2K6PVK6_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PVK6
UniRef90_P42765
397
I7G666I7G666_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_I7G666
UniRef90_P42765
397

Sequence

Representative sequenceiLengthMass (Da)Tools
P42765

Checksumi: 380CC8262ACF6D01

FASTA39741,924
        10         20         30         40         50
MALLRGVFVV AAKRTPFGAY GGLLKDFTAT DLSEFAAKAA LSAGKVSPET
60 70 80 90 100
VDSVIMGNVL QSSSDAIYLA RHVGLRVGIP KETPALTINR LCGSGFQSIV
110 120 130 140 150
NGCQEICVKE AEVVLCGGTE SMSQAPYCVR NVRFGTKLGS DIKLEDSLWV
160 170 180 190 200
SLTDQHVQLP MAMTAENLAV KHKISREECD KYALQSQQRW KAANDAGYFN
210 220 230 240 250
DEMAPIEVKT KKGKQTMQVD EHARPQTTLE QLQKLPPVFK KDGTVTAGNA
260 270 280 290 300
SGVADGAGAV IIASEDAVKK HNFTPLARIV GYFVSGCDPS IMGIGPVPAI
310 320 330 340 350
SGALKKAGLS LKDMDLVEVN EAFAPQYLAV ERSLDLDISK TNVNGGAIAL
360 370 380 390
GHPLGGSGSR ITAHLVHELR RRGGKYAVGS ACIGGGQGIA VIIQSTA
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again