Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P45383 Protein RecA n=9646 RepID=RECA_VIBCH MDENKQKALAAALGQIEKQFGKGSIMRLGDNRAMDVETISTGSLSLDIALGAGGLPMGRI VEIFGPESSGKTTLTLELIAAAQREGKTCAFIDAEHALDPVYAKKLGVNIDELLVSQPDT GEQALEICDALARSGAVDVIVVDSVAALTPKAEIEGEMGDSHMGLQARMLSQAMRKLTGN LKQSNCMCIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRTGAIKEGEEVVGNE TRIKVVKNKIAAPFKEANTQIMYGQGFNREGELIDLGVKHKMVEKSGAWYSYNGDKIGQG KANACKYLKENPEIAKTLDKKLREMLLNPENMQLIAETSSAADDVEFGAVPEEF

Members

List component clusters with 100% or 90% identity.
1 to 25 of 9,646  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P45383RECA_VIBCHProtein RecAVibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)243277UniRef100_P45383
UniRef90_P45383
354Representative
A5F9B5RECA_VIBC3Protein RecAVibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395)345073UniRef100_A5F9B5
UniRef90_P45383
354
Q8DC51RECA_VIBVUProtein RecAVibrio vulnificus (strain CMCP6)216895UniRef100_Q8DC51
UniRef90_P45383
349
Q7MHR4RECA_VIBVYProtein RecAVibrio vulnificus (strain YJ016)196600UniRef100_Q8DC51
UniRef90_P45383
349
Q6XZ07RECA_VIBNAProtein RecAVibrio natriegens691UniRef100_Q6XZ07
UniRef90_P45383
348
Q87LR1RECA_VIBPAProtein RecAVibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)223926UniRef100_Q87LR1
UniRef90_P45383
347
Q08784RECA_ACEACProtein RecA (Fragment)Acetobacter aceti435UniRef100_Q08784
UniRef90_Q08784
182
B2GB15RECA_LACF3Protein RecALactobacillus fermentum (strain NBRC 3956 / LMG 18251)334390UniRef100_B2GB15
UniRef90_B2GB15
353
Q88UZ4RECA_LACPLProtein RecALactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)220668UniRef100_Q88UZ4
UniRef90_Q88UZ4
380
Q6KCK3RECA_LACPEProtein RecALactobacillus pentosus1589UniRef100_Q6KCK3
UniRef90_Q88UZ4
378
Q5HPQ6RECA_STAEQProtein RecAStaphylococcus epidermidis (strain ATCC 35984 / RP62A)176279UniRef100_Q5HPQ6
UniRef90_Q5HPQ6
349
Q8CPF4RECA_STAESProtein RecAStaphylococcus epidermidis (strain ATCC 12228)176280UniRef100_Q5HPQ6
UniRef90_Q5HPQ6
349
Q4L5Y8RECA_STAHJProtein RecAStaphylococcus haemolyticus (strain JCSC1435)279808UniRef100_Q4L5Y8
UniRef90_Q5HPQ6
348
A7X1S3RECA_STAA1Protein RecAStaphylococcus aureus (strain Mu3 / ATCC 700698)418127UniRef100_A7X1S3
UniRef90_Q5HPQ6
347
A6U1A4RECA_STAA2Protein RecAStaphylococcus aureus (strain JH1)359787UniRef100_A7X1S3
UniRef90_Q5HPQ6
347
A5ISG9RECA_STAA9Protein RecAStaphylococcus aureus (strain JH9)359786UniRef100_A7X1S3
UniRef90_Q5HPQ6
347
Q2YXN2RECA_STAABProtein RecAStaphylococcus aureus (strain bovine RF122 / ET3-1)273036UniRef100_A7X1S3
UniRef90_Q5HPQ6
347
Q5HGE6RECA_STAACProtein RecAStaphylococcus aureus (strain COL)93062UniRef100_A7X1S3
UniRef90_Q5HPQ6
347
A6QGI4RECA_STAAEProtein RecAStaphylococcus aureus (strain Newman)426430UniRef100_A7X1S3
UniRef90_Q5HPQ6
347
P68843RECA_STAAMProtein RecAStaphylococcus aureus (strain Mu50 / ATCC 700699)158878UniRef100_A7X1S3
UniRef90_Q5HPQ6
347
P68844RECA_STAANProtein RecAStaphylococcus aureus (strain N315)158879UniRef100_A7X1S3
UniRef90_Q5HPQ6
347
Q6GHF0RECA_STAARProtein RecAStaphylococcus aureus (strain MRSA252)282458UniRef100_A7X1S3
UniRef90_Q5HPQ6
347
Q6G9S8RECA_STAASProtein RecAStaphylococcus aureus (strain MSSA476)282459UniRef100_A7X1S3
UniRef90_Q5HPQ6
347
A8Z1V6RECA_STAATProtein RecAStaphylococcus aureus (strain USA300 / TCH1516)451516UniRef100_A7X1S3
UniRef90_Q5HPQ6
347
P68845RECA_STAAUProtein RecAStaphylococcus aureus1280UniRef100_A7X1S3
UniRef90_Q5HPQ6
347

Sequence

Representative sequenceiLengthMass (Da)Tools
P45383

Checksumi: A1CCEF47C8771A8C

FASTA35438,250
        10         20         30         40         50
MDENKQKALA AALGQIEKQF GKGSIMRLGD NRAMDVETIS TGSLSLDIAL
60 70 80 90 100
GAGGLPMGRI VEIFGPESSG KTTLTLELIA AAQREGKTCA FIDAEHALDP
110 120 130 140 150
VYAKKLGVNI DELLVSQPDT GEQALEICDA LARSGAVDVI VVDSVAALTP
160 170 180 190 200
KAEIEGEMGD SHMGLQARML SQAMRKLTGN LKQSNCMCIF INQIRMKIGV
210 220 230 240 250
MFGNPETTTG GNALKFYASV RLDIRRTGAI KEGEEVVGNE TRIKVVKNKI
260 270 280 290 300
AAPFKEANTQ IMYGQGFNRE GELIDLGVKH KMVEKSGAWY SYNGDKIGQG
310 320 330 340 350
KANACKYLKE NPEIAKTLDK KLREMLLNPE NMQLIAETSS AADDVEFGAV

PEEF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again