Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P48183 Photosystem II protein D1 n=10621 RepID=PSBA_MAIZE MTAILERRESTSLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDI DGIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFL LGVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTF NFMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYKFG QEEETYNIVAAHGYFGRLIFQYASFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGF NFNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLAALEVPYLNG

Members

List component clusters with 100% or 90% identity.
1 to 25 of 10,621  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P48183PSBA_MAIZEPhotosystem II protein D1Zea mays (Maize)4577UniRef100_P48183
UniRef90_P48183
353Representative
A1E9Q4PSBA_SORBIPhotosystem II protein D1Sorghum bicolor (Sorghum) (Sorghum vulgare)4558UniRef100_A1E9Q4
UniRef90_P48183
353
A8Y9F0PSBA_LOLPRPhotosystem II protein D1Lolium perenne (Perennial ryegrass)4522UniRef100_A1E9Q4
UniRef90_P48183
353
Q6L3B5PSBA_SACHYPhotosystem II protein D1Saccharum hybrid (Sugarcane)15819UniRef100_A1E9Q4
UniRef90_P48183
353
P0C157PSBA_SACOFPhotosystem II protein D1Saccharum officinarum (Sugarcane)4547UniRef100_A1E9Q4
UniRef90_P48183
353
Q33282PSBA_VIGUNPhotosystem II protein D1Vigna unguiculata (Cowpea)3917UniRef100_Q33282
UniRef90_P48183
353
Q6ENJ7PSBA_ORYNIPhotosystem II protein D1Oryza nivara (Indian wild rice) (Oryza sativa f. spontanea)4536UniRef100_Q6ENJ7
UniRef90_P48183
353
P0C432PSBA_ORYSAPhotosystem II protein D1Oryza sativa (Rice)4530UniRef100_Q6ENJ7
UniRef90_P48183
353
P0C433PSBA_ORYSIPhotosystem II protein D1Oryza sativa subsp. indica (Rice)39946UniRef100_Q6ENJ7
UniRef90_P48183
353
P0C434PSBA_ORYSJPhotosystem II protein D1Oryza sativa subsp. japonica (Rice)39947UniRef100_Q6ENJ7
UniRef90_P48183
353
Q01366PSBA_PHAVUPhotosystem II protein D1Phaseolus vulgaris (Kidney bean) (French bean)3885UniRef100_Q01366
UniRef90_P48183
353
A1E9Y8PSBA_AGRSTPhotosystem II protein D1Agrostis stolonifera (Creeping bentgrass)63632UniRef100_A1E9Y8
UniRef90_P48183
353
P51764PSBA_MICAEPhotosystem II protein D1Microcystis aeruginosa1126UniRef100_P51764
UniRef90_B0JIS8
360
P07063PSBA_MICDPPhotosystem II protein D1Microchaete diplosiphon (Fremyella diplosiphon)1197UniRef100_P07063
UniRef90_B0JIS8
360
B0JIS8PSBA_MICANPhotosystem II protein D1Microcystis aeruginosa (strain NIES-843)449447UniRef100_B0JIS8
UniRef90_B0JIS8
360
P51759PSBA_CROS5Photosystem II protein D1Crocosphaera subtropica (strain ATCC 51142 / BH68) (Cyanothece sp. (strain ATCC 51142))43989UniRef100_P51759
UniRef90_P51759
356
Q8YQS7PSBA3_NOSS1Photosystem II protein D1 3Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576)103690UniRef100_Q8YQS7
UniRef90_Q8YQS7
360
Q3MCT0PSBA1_TRIV2Photosystem II protein D1 1Trichormus variabilis (strain ATCC 29413 / PCC 7937) (Anabaena variabilis)240292UniRef100_Q3MCT0
UniRef90_Q8YQS7
360
Q3AV15PSBA2_SYNS9Photosystem II protein D1 2Synechococcus sp. (strain CC9902)316279UniRef100_Q3AV15
UniRef90_Q7TTJ7
359
A5GIM7PSBA1_SYNPWPhotosystem II protein D1 1Synechococcus sp. (strain WH7803)32051UniRef100_A5GIM7
UniRef90_Q7TTJ7
359
Q0I7J2PSBA1_SYNS3Photosystem II protein D1 1Synechococcus sp. (strain CC9311)64471UniRef100_Q0I7J2
UniRef90_Q7TTJ7
359
Q0I912PSBA2_SYNS3Photosystem II protein D1 2Synechococcus sp. (strain CC9311)64471UniRef100_Q0I7J2
UniRef90_Q7TTJ7
359
Q7U4Z3PSBA3_SYNPXPhotosystem II protein D1 3Synechococcus sp. (strain WH8102)84588UniRef100_Q7U4Z3
UniRef90_Q7TTJ7
359
Q3AM89PSBA1_SYNSCPhotosystem II protein D1 1Synechococcus sp. (strain CC9605)110662UniRef100_Q3AM89
UniRef90_Q7TTJ7
359
A5GTY4PSBA1_SYNR3Photosystem II protein D1 1Synechococcus sp. (strain RCC307)316278UniRef100_A5GTY4
UniRef90_Q7TTJ7
359

Sequence

Representative sequenceiLengthMass (Da)Tools
P48183

Checksumi: AA6BFB415FCE1C79

FASTA35339,011
        10         20         30         40         50
MTAILERRES TSLWGRFCNW ITSTENRLYI GWFGVLMIPT LLTATSVFII
60 70 80 90 100
AFIAAPPVDI DGIREPVSGS LLYGNNIISG AIIPTSAAIG LHFYPIWEAA
110 120 130 140 150
SVDEWLYNGG PYELIVLHFL LGVACYMGRE WELSFRLGMR PWIAVAYSAP
160 170 180 190 200
VAAATAVFLI YPIGQGSFSD GMPLGISGTF NFMIVFQAEH NILMHPFHML
210 220 230 240 250
GVAGVFGGSL FSAMHGSLVT SSLIRETTEN ESANEGYKFG QEEETYNIVA
260 270 280 290 300
AHGYFGRLIF QYASFNNSRS LHFFLAAWPV VGIWFTALGI STMAFNLNGF
310 320 330 340 350
NFNQSVVDSQ GRVINTWADI INRANLGMEV MHERNAHNFP LDLAALEVPY

LNG
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again