Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P51589 Cytochrome P450 2J2 n=471 Tax=Euteleostomi TaxID=117571 RepID=CP2J2_HUMAN MLAAMGSLAAALWAVVHPRTLLLGTVAFLLAADFLKRRRPKNYPPGPWRLPFLGNFFLVD FEQSHLEVQLFVKKYGNLFSLELGDISAVLITGLPLIKEALIHMDQNFGNRPVTPMREHI FKKNGLIMSSGQAWKEQRRFTLTALRNFGLGKKSLEERIQEEAQHLTEAIKEENGQPFDP HFKINNAVSNIICSITFGERFEYQDSWFQQLLKLLDEVTYLEASKTCQLYNVFPWIMKFL PGPHQTLFSNWKKLKLFVSHMIDKHRKDWNPAETRDFIDAYLKEMSKHTGNPTSSFHEEN LICSTLDLFFAGTETTSTTLRWALLYMALYPEIQEKVQAEIDRVIGQGQQPSTAARESMP YTNAVIHEVQRMGNIIPLNVPREVTVDTTLAGYHLPKGTMILTNLTALHRDPTEWATPDT FNPDHFLENGQFKKREAFMPFSIGKRACLGEQLARTELFIFFTSLMQKFTFRPPNNEKLS LKFRMGITISPVSHRLCAVPQV

Members

List component clusters with 100% or 90% identity.
1 to 25 of 471  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P51589CP2J2_HUMANCytochrome P450 2J2Homo sapiens (Human)9606UniRef100_P51589
UniRef90_P51589
502Representative
O54749CP2J5_MOUSECytochrome P450 2J5Mus musculus (Mouse)10090UniRef100_O54749
UniRef90_O54749
501
P52786CP2J1_RABITCytochrome P450 2J1Oryctolagus cuniculus (Rabbit)9986UniRef100_P52786
UniRef90_P52786
501
P51590CP2J3_RATCytochrome P450 2J3Rattus norvegicus (Rat)10116UniRef100_P51590
UniRef90_P51590
502
Q96RX4Q96RX4_HUMANCytochrome P450 (Fragment)Homo sapiens (Human)9606UniRef100_P51589
UniRef90_P51589
32
H2PZ51H2PZ51_PANTRCYP2J2 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_H2PZ51
UniRef90_P51589
502
A0A2K6Q0D1A0A2K6Q0D1_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6Q0D1
UniRef90_P51589
502
G7NW05G7NW05_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7NW05
UniRef90_P51589
502
A0A2K5J9U8A0A2K5J9U8_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5J9U8
UniRef90_P51589
502
A0A2K6BF47A0A2K6BF47_MACNEUncharacterized proteinMacaca nemestrina (Pig-tailed macaque)9545UniRef100_A0A2K6BF47
UniRef90_P51589
502
A0A1D5RKR8A0A1D5RKR8_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5RKR8
UniRef90_P51589
502
A0A2K5Y159A0A2K5Y159_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5Y159
UniRef90_P51589
502
A0A2K5W982A0A2K5W982_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_A0A2K5W982
UniRef90_P51589
502
A0A096MWY5A0A096MWY5_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A096MWY5
UniRef90_P51589
502
A0A2K5NCN0A0A2K5NCN0_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A096MWY5
UniRef90_P51589
502
A0A0D9S747A0A0D9S747_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9S747
UniRef90_P51589
502
A0A2K6LAR0A0A2K6LAR0_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6LAR0
UniRef90_P51589
502
G1RXP9G1RXP9_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1RXP9
UniRef90_P51589
502
H2N781H2N781_PONABCYP2J2 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2N781
UniRef90_P51589
502
G7MHA6G7MHA6_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_G7MHA6
UniRef90_P51589
502
A8CBQ8A8CBQ8_MACFACytochrome P450 2J2Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7MHA6
UniRef90_P51589
502
A0A2R9C539A0A2R9C539_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9C539
UniRef90_P51589
502
G3QGX0G3QGX0_GORGOCytochrome P450 family 2 subfamily J member 2Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3QGX0
UniRef90_P51589
501
A0A1P8NQJ2A0A1P8NQJ2_CALJACytochrome P450 2J2Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A1P8NQJ2
UniRef90_P51589
498
F6R308F6R308_CALJAUncharacterized proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A1P8NQJ2
UniRef90_P51589
399

Sequence

Representative sequenceiLengthMass (Da)Tools
P51589

Checksumi: B5F006581E249EC0

FASTA50257,611
        10         20         30         40         50
MLAAMGSLAA ALWAVVHPRT LLLGTVAFLL AADFLKRRRP KNYPPGPWRL
60 70 80 90 100
PFLGNFFLVD FEQSHLEVQL FVKKYGNLFS LELGDISAVL ITGLPLIKEA
110 120 130 140 150
LIHMDQNFGN RPVTPMREHI FKKNGLIMSS GQAWKEQRRF TLTALRNFGL
160 170 180 190 200
GKKSLEERIQ EEAQHLTEAI KEENGQPFDP HFKINNAVSN IICSITFGER
210 220 230 240 250
FEYQDSWFQQ LLKLLDEVTY LEASKTCQLY NVFPWIMKFL PGPHQTLFSN
260 270 280 290 300
WKKLKLFVSH MIDKHRKDWN PAETRDFIDA YLKEMSKHTG NPTSSFHEEN
310 320 330 340 350
LICSTLDLFF AGTETTSTTL RWALLYMALY PEIQEKVQAE IDRVIGQGQQ
360 370 380 390 400
PSTAARESMP YTNAVIHEVQ RMGNIIPLNV PREVTVDTTL AGYHLPKGTM
410 420 430 440 450
ILTNLTALHR DPTEWATPDT FNPDHFLENG QFKKREAFMP FSIGKRACLG
460 470 480 490 500
EQLARTELFI FFTSLMQKFT FRPPNNEKLS LKFRMGITIS PVSHRLCAVP

QV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again