Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P51617 Interleukin-1 receptor-associated kinase 1 n=124 Tax=Boreoeutheria TaxID=1437010 RepID=IRAK1_HUMAN MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCE RSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSS IPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTK PGPESSVSLLQGARPFPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKR LKENADLEWTAVKQSFLTEVEQLSRFRHPNIVDFAGYCAQNGFYCLVYGFLPNGSLEDRL HCQTQACPPLSWPQRLDILLGTARAIQFLHQDSPSLIHGDIKSSNVLLDERLTPKLGDFG LARFSRFAGSSPSQSSMVARTQTVRGTLAYLPEEYIKTGRLAVDTDTFSFGVVVLETLAG QRAVKTHGARTKYLKDLVEEEAEEAGVALRSTQSTLQAGLAADAWAAPIAMQIYKKHLDP RPGPCPPELGLGLGQLACCCLHRRAKRRPPMTQVYERLEKLQAVVAGVPGHSEAASCIPP SPQENSYVSSTGRAHSGAAPWQPLAAPSGASAQAAEQLQRGPNQPVESDESLGGLSAALR SWHLTPSCPLDPAPLREAGCPQGDTAGESSWGSGPGSRPTAVEGLALGSSASSSSEPPQI IINPARQKMVQKLALYEDGALDSLQLLSSSSLPGLGLEQDRQGPEESDEFQS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 124  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P51617IRAK1_HUMANInterleukin-1 receptor-associated kinase 1Homo sapiens (Human)9606UniRef100_P51617
UniRef90_P51617
712Representative
Q2LGB3IRAK1_BOVINInterleukin-1 receptor-associated kinase 1Bos taurus (Bovine)9913UniRef100_Q2LGB3
UniRef90_Q2LGB3
718
A0A2R9BYL6A0A2R9BYL6_PANPAProtein kinase domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9BYL6
UniRef90_P51617
712
H2QZA3H2QZA3_PANTRIRAK1 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_H2QZA3
UniRef90_P51617
712
A0A2J8RLP6A0A2J8RLP6_PONABIRAK1 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8RLP6
UniRef90_P51617
712
A0A2K6RF36A0A2K6RF36_RHIROProtein kinase domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RF36
UniRef90_P51617
707
A0A2K6LS78A0A2K6LS78_RHIBEProtein kinase domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6LS78
UniRef90_P51617
702
A0A2K6LS72A0A2K6LS72_RHIBEProtein kinase domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6LS72
UniRef90_P51617
699
A0A2R9BZ57A0A2R9BZ57_PANPAProtein kinase domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9BZ57
UniRef90_P51617
686
A0A2K5IS91A0A2K5IS91_COLAPProtein kinase domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5IS91
UniRef90_P51617-3
628
A0A096MMT5A0A096MMT5_PAPANProtein kinase domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A096MMT5
UniRef90_P51617-3
712
G3RR89G3RR89_GORGOInterleukin 1 receptor associated kinase 1Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RR89
UniRef90_P51617-3
712
A0A2K5P1D9A0A2K5P1D9_CERATProtein kinase domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5P1D9
UniRef90_P51617-3
709
A0A2J8INB6A0A2J8INB6_PANTRIRAK1 isoform 7Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8INB6
UniRef90_P51617-3
708
D3YTB5D3YTB5_HUMANInterleukin-1 receptor-associated kinase 1Homo sapiens (Human)9606UniRef100_D3YTB5
UniRef90_P51617-3
708
A0A2K6RF11A0A2K6RF11_RHIROProtein kinase domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RF11
UniRef90_P51617-3
703
P51617-3Isoform 3 of IRAK1_HUMAN3Homo sapiens (Human)9606UniRef100_P51617-3
UniRef90_P51617-3
693
F6WX15F6WX15_MACMUProtein kinase domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F6WX15
UniRef90_P51617-3
690
A0A0D9R3A0A0A0D9R3A0_CHLSBProtein kinase domain-containing proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9R3A0
UniRef90_P51617-3
686
U3BQE8U3BQE8_CALJAInterleukin-1 receptor-associated kinase 1 isoform 2Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3BQE8
UniRef90_P51617-3
682
A0A2K5Q711A0A2K5Q711_CEBCAProtein kinase domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5Q711
UniRef90_P51617-3
633
F7I281F7I281_CALJAProtein kinase domain-containing proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7I281
UniRef90_P51617-3
633
A0A2K5DZ31A0A2K5DZ31_AOTNAProtein kinase domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5DZ31
UniRef90_P51617-3
632
A0A2K6RF45A0A2K6RF45_RHIROProtein kinase domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6RF45
UniRef90_P51617-3
628
A0A2K6LS94A0A2K6LS94_RHIBEProtein kinase domain-containing proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6LS94
UniRef90_P51617-3
626

Sequence

Representative sequenceiLengthMass (Da)Tools
P51617

Checksumi: A7ADED75D3A3981D

FASTA71276,537
        10         20         30         40         50
MAGGPGPGEP AAPGAQHFLY EVPPWVMCRF YKVMDALEPA DWCQFAALIV
60 70 80 90 100
RDQTELRLCE RSGQRTASVL WPWINRNARV ADLVHILTHL QLLRARDIIT
110 120 130 140 150
AWHPPAPLPS PGTTAPRPSS IPAPAEAEAW SPRKLPSSAS TFLSPAFPGS
160 170 180 190 200
QTHSGPELGL VPSPASLWPP PPSPAPSSTK PGPESSVSLL QGARPFPFCW
210 220 230 240 250
PLCEISRGTH NFSEELKIGE GGFGCVYRAV MRNTVYAVKR LKENADLEWT
260 270 280 290 300
AVKQSFLTEV EQLSRFRHPN IVDFAGYCAQ NGFYCLVYGF LPNGSLEDRL
310 320 330 340 350
HCQTQACPPL SWPQRLDILL GTARAIQFLH QDSPSLIHGD IKSSNVLLDE
360 370 380 390 400
RLTPKLGDFG LARFSRFAGS SPSQSSMVAR TQTVRGTLAY LPEEYIKTGR
410 420 430 440 450
LAVDTDTFSF GVVVLETLAG QRAVKTHGAR TKYLKDLVEE EAEEAGVALR
460 470 480 490 500
STQSTLQAGL AADAWAAPIA MQIYKKHLDP RPGPCPPELG LGLGQLACCC
510 520 530 540 550
LHRRAKRRPP MTQVYERLEK LQAVVAGVPG HSEAASCIPP SPQENSYVSS
560 570 580 590 600
TGRAHSGAAP WQPLAAPSGA SAQAAEQLQR GPNQPVESDE SLGGLSAALR
610 620 630 640 650
SWHLTPSCPL DPAPLREAGC PQGDTAGESS WGSGPGSRPT AVEGLALGSS
660 670 680 690 700
ASSSSEPPQI IINPARQKMV QKLALYEDGA LDSLQLLSSS SLPGLGLEQD
710
RQGPEESDEF QS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again