Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P61020 Ras-related protein Rab-5B n=65 Tax=Bilateria TaxID=33213 RepID=RAB5B_HUMAN MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQ SVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQR QASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKK LPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN

Members

List component clusters with 100% or 90% identity.
1 to 25 of 65  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P61020RAB5B_HUMANRas-related protein Rab-5BHomo sapiens (Human)9606UniRef100_P61020
UniRef90_P61020
215Representative
P61021RAB5B_MOUSERas-related protein Rab-5BMus musculus (Mouse)10090UniRef100_P61020
UniRef90_P61020
215
Q5RBG1RAB5B_PONABRas-related protein Rab-5BPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P61020
UniRef90_P61020
215
Q5ZHW4RAB5B_CHICKRas-related protein Rab-5BGallus gallus (Chicken)9031UniRef100_Q5ZHW4
UniRef90_Q5ZHW4
215
A0A0A0MXN5A0A0A0MXN5_PONABUncharacterized proteinPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P61020
UniRef90_P61020
285
U6DY05U6DY05_NEOVIRas-related protein Rab-5B (Fragment)Neovison vison (American mink) (Mustela vison)452646UniRef100_P61020
UniRef90_P61020
142
A0A024RB09A0A024RB09_HUMANRAB5B, member RAS oncogene family, isoform CRA_aHomo sapiens (Human)9606UniRef100_P61020
UniRef90_P61020
215
A0A2J8UHV6A0A2J8UHV6_PONABRAB5B isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P61020
UniRef90_P61020
215
A0A2Y9FUJ5A0A2Y9FUJ5_PHYMCras-related protein Rab-5BPhyseter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef100_P61020
UniRef90_P61020
215
U3EFM6U3EFM6_CALJARas-related protein Rab-5B isoform 1Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_P61020
UniRef90_P61020
215
A0A2Y9N845A0A2Y9N845_DELLEras-related protein Rab-5BDelphinapterus leucas (Beluga whale)9749UniRef100_P61020
UniRef90_P61020
215
K7D6I0K7D6I0_PANTRRAB5B isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_P61020
UniRef90_P61020
215
A0A3Q7SMI7A0A3Q7SMI7_VULVUras-related protein Rab-5BVulpes vulpes (Red fox)9627UniRef100_P61020
UniRef90_P61020
215
A0A2Y9L023A0A2Y9L023_ENHLUras-related protein Rab-5B isoform X1Enhydra lutris kenyoni391180UniRef100_P61020
UniRef90_P61020
215
A0A4U5SKE5A0A4U5SKE5_CAMDRUncharacterized proteinCamelus dromedarius (Dromedary) (Arabian camel)9838UniRef100_P61020
UniRef90_P61020
215
A0A2U3XBJ7A0A2U3XBJ7_LEPWEras-related protein Rab-5B isoform X1Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_P61020
UniRef90_P61020
215
A0A2Y9GU78A0A2Y9GU78_NEOSCras-related protein Rab-5B isoform X1Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_P61020
UniRef90_P61020
215
A0A2R9B4V1A0A2R9B4V1_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_P61020
UniRef90_P61020
215
A0A3Q7Q8R4A0A3Q7Q8R4_CALURras-related protein Rab-5BCallorhinus ursinus (Northern fur seal)34884UniRef100_P61020
UniRef90_P61020
215
A0A2U3ZYN7A0A2U3ZYN7_TURTRras-related protein Rab-5B isoform X2Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739UniRef100_P61020
UniRef90_P61020
215
A0A2Y9R4C6A0A2Y9R4C6_TRIMAras-related protein Rab-5BTrichechus manatus latirostris (Florida manatee)127582UniRef100_P61020
UniRef90_P61020
215
A0A341ATE0A0A341ATE0_9CETAras-related protein Rab-5BNeophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_P61020
UniRef90_P61020
215
G1S735G1S735_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_P61020
UniRef90_P61020
215
E2QW69E2QW69_CANLFRAB5B, member RAS oncogene familyCanis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_P61020
UniRef90_P61020
215
A0A2K6F7T6A0A2K6F7T6_PROCOUncharacterized proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_P61020
UniRef90_P61020
215

Sequence

Representative sequenceiLengthMass (Da)Tools
P61020

Checksumi: D47AD834BCF8B591

FASTA21523,707
        10         20         30         40         50
MTSRSTARPN GQPQASKICQ FKLVLLGESA VGKSSLVLRF VKGQFHEYQE
60 70 80 90 100
STIGAAFLTQ SVCLDDTTVK FEIWDTAGQE RYHSLAPMYY RGAQAAIVVY
110 120 130 140 150
DITNQETFAR AKTWVKELQR QASPSIVIAL AGNKADLANK RMVEYEEAQA
160 170 180 190 200
YADDNSLLFM ETSAKTAMNV NDLFLAIAKK LPKSEPQNLG GAAGRSRGVD
210
LHEQSQQNKS QCCSN
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again