Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P63005 Platelet-activating factor acetylhydrolase IB subunit alpha n=507 Tax=Bilateria TaxID=33213 RepID=LIS1_MOUSE MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDMNEELDKKYAGLLEKKWTSVIR LQKKVMELESKLNEAKEEFTSGGPLGQKRDPKEWIPRPPEKYALSGHRSPVTRVIFHPVF SVMVSASEDATIKVWDYETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWDFQ GFECIRTMHGHDHNVSSVAIMPNGDHIVSASRDKTIKMWEVQTGYCVKTFTGHREWVRMV RPNQDGTLIASCSNDQTVRVWVVATKECKAELREHEHVVECISWAPESSYSSISEATGSE TKKSGKPGPFLLSGSRDKTIKMWDVSTGMCLMTLVGHDNWVRGVLFHSGGKFILSCADDK TLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTAPYVVTGSVDQTVKVWECR

Members

List component clusters with 100% or 90% identity.
1 to 25 of 507  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P63005LIS1_MOUSEPlatelet-activating factor acetylhydrolase IB subunit alphaMus musculus (Mouse)10090UniRef100_P63005
UniRef90_P63005
410Representative
B0LSW3LIS1_FELCAPlatelet-activating factor acetylhydrolase IB subunit alphaFelis catus (Cat) (Felis silvestris catus)9685UniRef100_P63005
UniRef90_P63005
410
P63004LIS1_RATPlatelet-activating factor acetylhydrolase IB subunit alphaRattus norvegicus (Rat)10116UniRef100_P63005
UniRef90_P63005
410
Q9GL51LIS1_PIGPlatelet-activating factor acetylhydrolase IB subunit alphaSus scrofa (Pig)9823UniRef100_Q9GL51
UniRef90_P63005
410
Q8HXX0LIS1_MACFAPlatelet-activating factor acetylhydrolase IB subunit alphaMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_Q8HXX0
UniRef90_P63005
410
P43034LIS1_HUMANPlatelet-activating factor acetylhydrolase IB subunit alphaHomo sapiens (Human)9606UniRef100_P43034
UniRef90_P63005
410
P43033LIS1_BOVINPlatelet-activating factor acetylhydrolase IB subunit alphaBos taurus (Bovine)9913UniRef100_P43033
UniRef90_P63005
410
Q5REG7LIS1_PONABPlatelet-activating factor acetylhydrolase IB subunit alphaPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5REG7
UniRef90_P63005
410
Q5IS43LIS1_PANTRPlatelet-activating factor acetylhydrolase IB subunit alphaPan troglodytes (Chimpanzee)9598UniRef100_Q5IS43
UniRef90_P63005
410
Q9PTR5LIS1_CHICKLissencephaly-1 homologGallus gallus (Chicken)9031UniRef100_Q9PTR5
UniRef90_P63005
410
B5X3C4LIS1B_SALSALissencephaly-1 homolog BSalmo salar (Atlantic salmon)8030UniRef100_B5X3C4
UniRef90_Q803D2
410
Q803D2LIS1B_DANRELissencephaly-1 homolog BDanio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_Q803D2
UniRef90_Q803D2
410
Q4RJN5LIS1_TETNGLissencephaly-1 homologTetraodon nigroviridis (Spotted green pufferfish) (Chelonodon nigroviridis)99883UniRef100_Q4RJN5
UniRef90_Q803D2
410
Q7T394LIS1A_DANRELissencephaly-1 homolog ADanio rerio (Zebrafish) (Brachydanio rerio)7955UniRef100_Q7T394
UniRef90_Q803D2
410
B5X3Z6LIS1A_SALSALissencephaly-1 homolog ASalmo salar (Atlantic salmon)8030UniRef100_B5X3Z6
UniRef90_B5X3Z6
410
Q6NZH4LIS1_XENTRLissencephaly-1 homologXenopus tropicalis (Western clawed frog) (Silurana tropicalis)8364UniRef100_Q6NZH4
UniRef90_Q6NZH4
410
Q90ZL4LIS1_XENLALissencephaly-1 homologXenopus laevis (African clawed frog)8355UniRef100_Q90ZL4
UniRef90_Q6NZH4
410
F2Z521F2Z521_PIGPlatelet-activating factor acetylhydrolase IB subunit alphaSus scrofa (Pig)9823UniRef100_P63005
UniRef90_P63005
410
A0A4X1UCH0A0A4X1UCH0_PIGPlatelet-activating factor acetylhydrolase IB subunit alphaSus scrofa (Pig)9823UniRef100_P63005
UniRef90_P63005
410
A0A2U3W7I7A0A2U3W7I7_ODOROPlatelet-activating factor acetylhydrolase IB subunit alphaOdobenus rosmarus divergens (Pacific walrus)9708UniRef100_P63005
UniRef90_P63005
410
A0A2Y9I8T3A0A2Y9I8T3_NEOSCPlatelet-activating factor acetylhydrolase IB subunit alphaNeomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_P63005
UniRef90_P63005
410
H2NS76H2NS76_PONABPlatelet-activating factor acetylhydrolase IB subunit alphaPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P63005
UniRef90_P63005
410
A0A4W2FPG4A0A4W2FPG4_BOBOXPlatelet-activating factor acetylhydrolase IB subunit alphaBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_P63005
UniRef90_P63005
410
F7HWL4F7HWL4_CALJAPlatelet-activating factor acetylhydrolase IB subunit alphaCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_P63005
UniRef90_P63005
410
A0A1U7ULY2A0A1U7ULY2_TARSYPlatelet-activating factor acetylhydrolase IB subunit alphaTarsius syrichta (Philippine tarsier)1868482UniRef100_P63005
UniRef90_P63005
410

Sequence

Representative sequenceiLengthMass (Da)Tools
P63005

Checksumi: 4DBF6A24A6B131CD

FASTA41046,670
        10         20         30         40         50
MVLSQRQRDE LNRAIADYLR SNGYEEAYSV FKKEAELDMN EELDKKYAGL
60 70 80 90 100
LEKKWTSVIR LQKKVMELES KLNEAKEEFT SGGPLGQKRD PKEWIPRPPE
110 120 130 140 150
KYALSGHRSP VTRVIFHPVF SVMVSASEDA TIKVWDYETG DFERTLKGHT
160 170 180 190 200
DSVQDISFDH SGKLLASCSA DMTIKLWDFQ GFECIRTMHG HDHNVSSVAI
210 220 230 240 250
MPNGDHIVSA SRDKTIKMWE VQTGYCVKTF TGHREWVRMV RPNQDGTLIA
260 270 280 290 300
SCSNDQTVRV WVVATKECKA ELREHEHVVE CISWAPESSY SSISEATGSE
310 320 330 340 350
TKKSGKPGPF LLSGSRDKTI KMWDVSTGMC LMTLVGHDNW VRGVLFHSGG
360 370 380 390 400
KFILSCADDK TLRVWDYKNK RCMKTLNAHE HFVTSLDFHK TAPYVVTGSV
410
DQTVKVWECR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again