Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P63146 Ubiquitin-conjugating enzyme E2 B n=140 Tax=cellular organisms TaxID=131567 RepID=UBE2B_HUMAN MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFEDGTFKLVIEFS EEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNS PANSQAAQLYQENKREYEKRVSAIVEQSWNDS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 140  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P63146UBE2B_HUMANUbiquitin-conjugating enzyme E2 BHomo sapiens (Human)9606UniRef100_P63146
UniRef90_P63146
152Representative
Q32P99UBE2B_BOVINUbiquitin-conjugating enzyme E2 BBos taurus (Bovine)9913UniRef100_P63146
UniRef90_P63146
152
P63147UBE2B_MOUSEUbiquitin-conjugating enzyme E2 BMus musculus (Mouse)10090UniRef100_P63146
UniRef90_P63146
152
P63148UBE2B_RABITUbiquitin-conjugating enzyme E2 BOryctolagus cuniculus (Rabbit)9986UniRef100_P63146
UniRef90_P63146
152
P63149UBE2B_RATUbiquitin-conjugating enzyme E2 BRattus norvegicus (Rat)10116UniRef100_P63146
UniRef90_P63146
152
A0A452UTW0A0A452UTW0_URSMAUBIQUITIN_CONJUGAT_2 domain-containing proteinUrsus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_P63146
UniRef90_P63146
232
H8Y100H8Y100_PIGUbiquitin-conjugating enzyme E2 BSus scrofa (Pig)9823UniRef100_P63146
UniRef90_P63146
152
L8IYN1L8IYN1_9CETAUbiquitin-conjugating enzyme E2 BBos mutus (wild yak)72004UniRef100_P63146
UniRef90_P63146
152
I7GLU2I7GLU2_MACFAMacaca fascicularis brain cDNA clone: QflA-19656, similar to human ubiquitin-conjugating enzyme E2B (RAD6 homolog)(UBE2B), mRNA, RefSeq: NM_003337.2Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_P63146
UniRef90_P63146
152
H2PGK2H2PGK2_PONABUBE2B isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P63146
UniRef90_P63146
152
A0A4W2FHQ0A0A4W2FHQ0_BOBOXUBIQUITIN_CONJUGAT_2 domain-containing proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_P63146
UniRef90_P63146
152
H9YWP0H9YWP0_MACMUUbiquitin-conjugating enzyme E2 BMacaca mulatta (Rhesus macaque)9544UniRef100_P63146
UniRef90_P63146
152
H2R5C5H2R5C5_PANTRUBE2B isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_P63146
UniRef90_P63146
152
F7HM77F7HM77_CALJAUbiquitin-conjugating enzyme E2 BCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_P63146
UniRef90_P63146
152
A0A2K6R568A0A2K6R568_RHIROUBIQUITIN_CONJUGAT_2 domain-containing proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_P63146
UniRef90_P63146
152
A0A4U1EJ22A0A4U1EJ22_MONMOUBIQUITIN_CONJUGAT_2 domain-containing proteinMonodon monoceros (Narwhal) (Ceratodon monodon)40151UniRef100_P63146
UniRef90_P63146
152
W5PWV6W5PWV6_SHEEPUBIQUITIN_CONJUGAT_2 domain-containing proteinOvis aries (Sheep)9940UniRef100_P63146
UniRef90_P63146
152
A0A3Q7T707A0A3Q7T707_VULVUubiquitin-conjugating enzyme E2 BVulpes vulpes (Red fox)9627UniRef100_P63146
UniRef90_P63146
152
H0XF18H0XF18_OTOGAUBIQUITIN_CONJUGAT_2 domain-containing proteinOtolemur garnettii (Small-eared galago) (Garnett's greater bushbaby)30611UniRef100_P63146
UniRef90_P63146
152
A0A2Y9IKG6A0A2Y9IKG6_ENHLUubiquitin-conjugating enzyme E2 B isoform X1Enhydra lutris kenyoni391180UniRef100_P63146
UniRef90_P63146
152
A0A4U5TFN4A0A4U5TFN4_CAMDRUBIQUITIN_CONJUGAT_2 domain-containing proteinCamelus dromedarius (Dromedary) (Arabian camel)9838UniRef100_P63146
UniRef90_P63146
152
L5MHR3L5MHR3_MYODSUbiquitin-conjugating enzyme E2 BMyotis davidii (David's myotis)225400UniRef100_P63146
UniRef90_P63146
152
A0A2I2V336A0A2I2V336_FELCAUBIQUITIN_CONJUGAT_2 domain-containing proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_P63146
UniRef90_P63146
152
A0A2U3XHX2A0A2U3XHX2_LEPWEubiquitin-conjugating enzyme E2 B isoform X1Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_P63146
UniRef90_P63146
152
A0A2Y9I1R8A0A2Y9I1R8_NEOSCubiquitin-conjugating enzyme E2 BNeomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_P63146
UniRef90_P63146
152

Sequence

Representative sequenceiLengthMass (Da)Tools
P63146

Checksumi: CFDEEEE7E06840BE

FASTA15217,312
        10         20         30         40         50
MSTPARRRLM RDFKRLQEDP PVGVSGAPSE NNIMQWNAVI FGPEGTPFED
60 70 80 90 100
GTFKLVIEFS EEYPNKPPTV RFLSKMFHPN VYADGSICLD ILQNRWSPTY
110 120 130 140 150
DVSSILTSIQ SLLDEPNPNS PANSQAAQLY QENKREYEKR VSAIVEQSWN

DS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again