Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P67999 Ribosomal protein S6 kinase beta-1 n=808 Tax=Bilateria TaxID=33213 RepID=KS6B1_RAT MRRRRRRDGFYPAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL FMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLC KESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPPFTGENRKK TIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGPGDAGEVQAHPFFRHINWEEL LARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDSTLSESANQVFLGFTYVAPSVLE SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG IEQMDVTTSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 808  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P67999KS6B1_RATRibosomal protein S6 kinase beta-1Rattus norvegicus (Rat)10116UniRef100_P67999
UniRef90_P67999
525Representative
Q6TJY3KS6B1_BOVINRibosomal protein S6 kinase beta-1Bos taurus (Bovine)9913UniRef100_Q6TJY3
UniRef90_P67999
527
Q8BSK8KS6B1_MOUSERibosomal protein S6 kinase beta-1Mus musculus (Mouse)10090UniRef100_Q8BSK8
UniRef90_P67999
525
P23443KS6B1_HUMANRibosomal protein S6 kinase beta-1Homo sapiens (Human)9606UniRef100_P23443
UniRef90_P67999
525
P67998KS6B1_RABITRibosomal protein S6 kinase beta-1Oryctolagus cuniculus (Rabbit)9986UniRef100_P67998
UniRef90_P67999
525
L9KFR7L9KFR7_TUPCHRibosomal protein S6 kinaseTupaia chinensis (Chinese tree shrew)246437UniRef100_L9KFR7
UniRef90_P67999
559
K7EIM2K7EIM2_HUMANRibosomal protein S6 kinase beta-1 (Fragment)Homo sapiens (Human)9606UniRef100_L9KFR7
UniRef90_P67999
62
A0A287D547A0A287D547_ICTTRProtein kinase domain-containing proteinIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179UniRef100_L9KFR7
UniRef90_P67999
74
Q5SWG2Q5SWG2_MOUSERibosomal protein S6 kinase beta-1 (Fragment)Mus musculus (Mouse)10090UniRef100_L9KFR7
UniRef90_P67999
74
U6DWW0U6DWW0_NEOVIRibosomal protein S6 kinase, 70kDa, polypeptide 1 (Fragment)Neovison vison (American mink) (Mustela vison)452646UniRef100_L9KFR7
UniRef90_P67999
156
K9KCU1K9KCU1_HORSERibosomal protein S6 kinase beta-1-like protein (Fragment)Equus caballus (Horse)9796UniRef100_L9KFR7
UniRef90_P67999
348
A0A1S3AQW6A0A1S3AQW6_ERIEUribosomal protein S6 kinase beta-1-likeErinaceus europaeus (Western European hedgehog)9365UniRef100_L9KFR7
UniRef90_P67999
80
G9KLV3G9KLV3_MUSPFRibosomal protein S6 kinase, 70kDa, polypeptide 1 (Fragment)Mustela putorius furo (European domestic ferret) (Mustela furo)9669UniRef100_L9KFR7
UniRef90_P67999
189
A0A4W2BS57A0A4W2BS57_BOBOXRibosomal protein S6 kinaseBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_Q6TJY3
UniRef90_P67999
525
F1MNP4F1MNP4_BOVINRibosomal protein S6 kinaseBos taurus (Bovine)9913UniRef100_Q6TJY3
UniRef90_P67999
525
W5PYC2W5PYC2_SHEEPRibosomal protein S6 kinaseOvis aries (Sheep)9940UniRef100_Q6TJY3
UniRef90_P67999
478
L8ITP0L8ITP0_9CETARibosomal protein S6 kinase beta-1 (Fragment)Bos mutus (wild yak)72004UniRef100_Q6TJY3
UniRef90_P67999
478
G3WU29G3WU29_SARHARibosomal protein S6 kinaseSarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius)9305UniRef100_G3WU29
UniRef90_P67999
527
F7BTW0F7BTW0_MONDORibosomal protein S6 kinaseMonodelphis domestica (Gray short-tailed opossum)13616UniRef100_F7BTW0
UniRef90_P67999
526
F1S224F1S224_PIGRibosomal protein S6 kinaseSus scrofa (Pig)9823UniRef100_F1S224
UniRef90_P67999
525
A0A4X1STL0A0A4X1STL0_PIGRibosomal protein S6 kinaseSus scrofa (Pig)9823UniRef100_F1S224
UniRef90_P67999
525
A0A0B8RZ70A0A0B8RZ70_PIGRibosomal protein S6 kinaseSus scrofa domesticus (domestic pig)9825UniRef100_F1S224
UniRef90_P67999
525
A9NIU2A9NIU2_PIGRibosomal protein S6 kinase polypeptide 1 (Fragment)Sus scrofa (Pig)9823UniRef100_F1S224
UniRef90_P67999
166
A0A4X1SS87A0A4X1SS87_PIGRibosomal protein S6 kinaseSus scrofa (Pig)9823UniRef100_F1S224
UniRef90_P67999
472
G3TCW7G3TCW7_LOXAFRibosomal protein S6 kinaseLoxodonta africana (African elephant)9785UniRef100_G3TCW7
UniRef90_P67999
525

Sequence

Representative sequenceiLengthMass (Da)Tools
P67999

Checksumi: 013BA13EFB3508D7

FASTA52559,131
        10         20         30         40         50
MRRRRRRDGF YPAPDFRHRE AEDMAGVFDI DLDQPEDAGS EDELEEGGQL
60 70 80 90 100
NESMDHGGVG PYELGMEHCE KFEISETSVN RGPEKIRPEC FELLRVLGKG
110 120 130 140 150
GYGKVFQVRK VTGANTGKIF AMKVLKKAMI VRNAKDTAHT KAERNILEEV
160 170 180 190 200
KHPFIVDLIY AFQTGGKLYL ILEYLSGGEL FMQLEREGIF MEDTACFYLA
210 220 230 240 250
EISMALGHLH QKGIIYRDLK PENIMLNHQG HVKLTDFGLC KESIHDGTVT
260 270 280 290 300
HTFCGTIEYM APEILMRSGH NRAVDWWSLG ALMYDMLTGA PPFTGENRKK
310 320 330 340 350
TIDKILKCKL NLPPYLTQEA RDLLKKLLKR NAASRLGAGP GDAGEVQAHP
360 370 380 390 400
FFRHINWEEL LARKVEPPFK PLLQSEEDVS QFDSKFTRQT PVDSPDDSTL
410 420 430 440 450
SESANQVFLG FTYVAPSVLE SVKEKFSFEP KIRSPRRFIG SPRTPVSPVK
460 470 480 490 500
FSPGDFWGRG ASASTANPQT PVEYPMETSG IEQMDVTTSG EASAPLPIRQ
510 520
PNSGPYKKQA FPMISKRPEH LRMNL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again