Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P78310 Coxsackievirus and adenovirus receptor n=478 Tax=Gnathostomata TaxID=7776 RepID=CXAR_HUMAN MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLIS PADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQC KVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSD SQKMPTSWLAEMTSSVISVKNASSEYSGTYSCTVRNRVGSDQCLLRLNVVPPSNKAGLIA GAIIGTLLALALIGLIIFCCRKKRREEKYEKEVHHDIREDVPPPKSRTSTARSYIGSNHS SLGSMSPSNMEGYSKTQYNQVPSEDFERTPQSPTLPPAKVAAPNLSRMGAIPVMIPAQSK DGSIV

Members

List component clusters with 100% or 90% identity.
1 to 25 of 478  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P78310CXAR_HUMANCoxsackievirus and adenovirus receptorHomo sapiens (Human)9606UniRef100_P78310
UniRef90_P78310
365Representative
Q5R764CXAR_PONABCoxsackievirus and adenovirus receptor homologPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_P78310
UniRef90_P78310
365
H2QKV2H2QKV2_PANTRCXADR isoform 2Pan troglodytes (Chimpanzee)9598UniRef100_P78310
UniRef90_P78310
365
A0A452FP68A0A452FP68_CAPHIUncharacterized proteinCapra hircus (Goat)9925UniRef100_A0A452FP68
UniRef90_P78310
416
A0A3Q1LGE0A0A3Q1LGE0_BOVINCoxsackievirus and adenovirus receptor homologBos taurus (Bovine)9913UniRef100_A0A3Q1LGE0
UniRef90_P78310
378
A0A3Q1MQS2A0A3Q1MQS2_BOVINCoxsackievirus and adenovirus receptor homologBos taurus (Bovine)9913UniRef100_A0A3Q1LGE0
UniRef90_P78310
338
A0A2K5N7K1A0A2K5N7K1_CERATUncharacterized proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5N7K1
UniRef90_P78310
365
A0A2K5YJU8A0A2K5YJU8_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5N7K1
UniRef90_P78310
350
A0A287ALW2A0A287ALW2_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_A0A287ALW2
UniRef90_P78310
365
A0A286ZRH9A0A286ZRH9_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_A0A287ALW2
UniRef90_P78310
338
Q9TU79Q9TU79_PIGCoxsackie-adenovirus-receptor homolog (Fragment)Sus scrofa (Pig)9823UniRef100_A0A287ALW2
UniRef90_P78310
319
W5Q2S6W5Q2S6_SHEEPUncharacterized proteinOvis aries (Sheep)9940UniRef100_W5Q2S6
UniRef90_P78310
365
A0A2U3YA78A0A2U3YA78_LEPWEcoxsackievirus and adenovirus receptor homolog isoform X1Leptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A2U3YA78
UniRef90_P78310
365
L5KWT8L5KWT8_PTEALCoxsackievirus and adenovirus receptor like proteinPteropus alecto (Black flying fox)9402UniRef100_L5KWT8
UniRef90_P78310
365
G1QNK5G1QNK5_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1QNK5
UniRef90_P78310
365
A0A2Y9DB63A0A2Y9DB63_TRIMAcoxsackievirus and adenovirus receptorTrichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9DB63
UniRef90_P78310
365
A0A3Q7RXG9A0A3Q7RXG9_VULVUcoxsackievirus and adenovirus receptor isoform X1Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7RXG9
UniRef90_P78310
365
A0A2Y9EQN6A0A2Y9EQN6_PHYMCcoxsackievirus and adenovirus receptorPhyseter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef100_A0A2Y9EQN6
UniRef90_P78310
365
G5E6X0G5E6X0_LOXAFUncharacterized proteinLoxodonta africana (African elephant)9785UniRef100_G5E6X0
UniRef90_P78310
365
U6CQP9U6CQP9_NEOVICoxsackievirus and adenovirus receptorNeovison vison (American mink) (Mustela vison)452646UniRef100_U6CQP9
UniRef90_P78310
365
A0A2Y9N7K2A0A2Y9N7K2_DELLEcoxsackievirus and adenovirus receptor isoform X1Delphinapterus leucas (Beluga whale)9749UniRef100_A0A2Y9N7K2
UniRef90_P78310
365
A0A341AFA9A0A341AFA9_9CETAcoxsackievirus and adenovirus receptor isoform X1Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_A0A2Y9N7K2
UniRef90_P78310
365
H2P2S8H2P2S8_PONABCXADR isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2P2S8
UniRef90_P78310
365
H9FQG2H9FQG2_MACMUCoxsackievirus and adenovirus receptor isoform 1Macaca mulatta (Rhesus macaque)9544UniRef100_H9FQG2
UniRef90_P78310
365
A0A2K6P9I0A0A2K6P9I0_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_H9FQG2
UniRef90_P78310
365

Sequence

Representative sequenceiLengthMass (Da)Tools
P78310

Checksumi: AB01C6346CB7FE64

FASTA36540,030
        10         20         30         40         50
MALLLCFVLL CGVVDFARSL SITTPEEMIE KAKGETAYLP CKFTLSPEDQ
60 70 80 90 100
GPLDIEWLIS PADNQKVDQV IILYSGDKIY DDYYPDLKGR VHFTSNDLKS
110 120 130 140 150
GDASINVTNL QLSDIGTYQC KVKKAPGVAN KKIHLVVLVK PSGARCYVDG
160 170 180 190 200
SEEIGSDFKI KCEPKEGSLP LQYEWQKLSD SQKMPTSWLA EMTSSVISVK
210 220 230 240 250
NASSEYSGTY SCTVRNRVGS DQCLLRLNVV PPSNKAGLIA GAIIGTLLAL
260 270 280 290 300
ALIGLIIFCC RKKRREEKYE KEVHHDIRED VPPPKSRTST ARSYIGSNHS
310 320 330 340 350
SLGSMSPSNM EGYSKTQYNQ VPSEDFERTP QSPTLPPAKV AAPNLSRMGA
360
IPVMIPAQSK DGSIV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again