Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P78310-5 Isoform 5 of Coxsackievirus and adenovirus receptor n=12 Tax=Boreoeutheria TaxID=1437010 RepID=Isoform 5 of CXAR_HUMAN MALLLCFVLLCGVVDFARSLSITTPEEMIEKAKGETAYLPCKFTLSPEDQGPLDIEWLIS PADNQKVDQVIILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQC KVKKAPGVANKKIHLVVLVKPSGARCYVDGSEEIGSDFKIKCEPKEGSLPLQYEWQKLSD SQKMPTSWLAGKMCHLQRAVRPLPEATSAVIIHPWGPCLLPTWKDIPRLSITKYQVKTLN ALLRVRLSHLLR

Members

List component clusters with 100% or 90% identity.
1 to 12 of 12  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P78310-5Isoform 5 of CXAR_HUMAN5, CAR4/7, BetaHomo sapiens (Human)9606UniRef100_P78310-5
UniRef90_P78310-5
252Representative
A0A2I3RVU2A0A2I3RVU2_PANTRCXADR isoform 3Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RVU2
UniRef90_P78310-5
252
A0A2R8ZHT4A0A2R8ZHT4_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2I3RVU2
UniRef90_P78310-5
237
A0A2I2YCH1A0A2I2YCH1_GORGOCXADR, Ig-like cell adhesion moleculeGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I3RVU2
UniRef90_P78310-5
237
A0A2I3GV83A0A2I3GV83_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3GV83
UniRef90_P78310-5
252
A0A2J8TV30A0A2J8TV30_PONABCXADR isoform 2Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8TV30
UniRef90_P78310-5
252
A0A1D5Q8L1A0A1D5Q8L1_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5Q8L1
UniRef90_P78310-5
243
Q6DQX5Q6DQX5_RABITCoxsackie virus and adenovirus receptor (Fragment)Oryctolagus cuniculus (Rabbit)9986UniRef100_Q6DQX5
UniRef90_Q6DQX5
237
UPI0005D022EBcoxsackievirus and adenovirus receptor isoform X3Homo sapiens (Human)9606UniRef100_P78310-5
UniRef90_P78310-5
258
UPI0005CFF7B1coxsackievirus and adenovirus receptor isoform X2Homo sapiens (Human)9606UniRef100_UPI0005CFF7B1
UniRef90_P78310-5
278Seed
UPI0004BD5732coxsackievirus and adenovirus receptor isoform X3Equus przewalskii (Przewalski's horse) (Equus caballus przewalskii)9798UniRef100_UPI0004BD5732
UniRef90_UPI0004BD5732
243
UPI0001E30665Coxsackie and adenovirus receptorHomo sapiens (Human)9606UniRef100_UPI0001E30665
UniRef90_UPI0001E30665
225

Sequence

Representative sequenceiLengthMass (Da)Tools
P78310-5

Checksumi: 4532559D01AB67E2

FASTA25228,201
        10         20         30         40         50
MALLLCFVLL CGVVDFARSL SITTPEEMIE KAKGETAYLP CKFTLSPEDQ
60 70 80 90 100
GPLDIEWLIS PADNQKVDQV IILYSGDKIY DDYYPDLKGR VHFTSNDLKS
110 120 130 140 150
GDASINVTNL QLSDIGTYQC KVKKAPGVAN KKIHLVVLVK PSGARCYVDG
160 170 180 190 200
SEEIGSDFKI KCEPKEGSLP LQYEWQKLSD SQKMPTSWLA GKMCHLQRAV
210 220 230 240 250
RPLPEATSAV IIHPWGPCLL PTWKDIPRLS ITKYQVKTLN ALLRVRLSHL

LR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again