Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P78504 Protein jagged-1 n=366 Tax=Amniota TaxID=32524 RepID=JAG1_HUMAN MRSPRTRGRSGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSP KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYC GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWE GAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICA QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN GYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPR PCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCAN ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA WICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPTKHPNWTNKQ DNRDLESAQSLNRMEYIV

Members

List component clusters with 100% or 90% identity.
1 to 25 of 366  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P78504JAG1_HUMANProtein jagged-1Homo sapiens (Human)9606UniRef100_P78504
UniRef90_P78504
1,218Representative
Q63722JAG1_RATProtein jagged-1Rattus norvegicus (Rat)10116UniRef100_Q63722
UniRef90_Q9QXX0
1,219
Q9QXX0JAG1_MOUSEProtein jagged-1Mus musculus (Mouse)10090UniRef100_Q9QXX0
UniRef90_Q9QXX0
1,218
G7N2Z1G7N2Z1_MACMUDelta-like protein (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_P78504
UniRef90_P78504
1,190
P78504-2Isoform 2 of JAG1_HUMAN2Homo sapiens (Human)9606UniRef100_P78504
UniRef90_P78504
1,059
A0A2I3LH14A0A2I3LH14_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_P78504
UniRef90_P78504
998
B7U6M8B7U6M8_HUMANJagged 1 (Fragment)Homo sapiens (Human)9606UniRef100_P78504
UniRef90_P78504
38
A0A384D3M2A0A384D3M2_URSMADelta-like proteinUrsus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_A0A384D3M2
UniRef90_P78504
1,274
A0A452TSL7A0A452TSL7_URSMADelta-like proteinUrsus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_A0A452TSL7
UniRef90_P78504
1,220
A0A2U3XZY3A0A2U3XZY3_LEPWEDelta-like proteinLeptonychotes weddellii (Weddell seal) (Otaria weddellii)9713UniRef100_A0A2U3XZY3
UniRef90_P78504
1,218
A0A2K5PBM0A0A2K5PBM0_CEBCADelta-like proteinCebus capucinus imitator1737458UniRef100_A0A2K5PBM0
UniRef90_P78504
1,218
A0A3Q7WB70A0A3Q7WB70_URSARDelta-like proteinUrsus arctos horribilis116960UniRef100_A0A3Q7WB70
UniRef90_P78504
1,218
A0A2Y9INZ5A0A2Y9INZ5_ENHLUDelta-like proteinEnhydra lutris kenyoni391180UniRef100_A0A2Y9INZ5
UniRef90_P78504
1,218
G5B2B0G5B2B0_HETGADelta-like proteinHeterocephalus glaber (Naked mole rat)10181UniRef100_G5B2B0
UniRef90_P78504
1,218
F7HER3F7HER3_CALJADelta-like proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7HER3
UniRef90_P78504
1,218
A0A2K5CSY3A0A2K5CSY3_AOTNADelta-like proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5CSY3
UniRef90_P78504
1,218
E2QUR0E2QUR0_CANLFDelta-like proteinCanis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_E2QUR0
UniRef90_P78504
1,218
A0A3Q7SW53A0A3Q7SW53_VULVUDelta-like proteinVulpes vulpes (Red fox)9627UniRef100_A0A3Q7SW53
UniRef90_P78504
1,218
A0A3P4MCH6A0A3P4MCH6_GULGUDelta-like proteinGulo gulo (Wolverine) (Gluton)48420UniRef100_A0A3P4MCH6
UniRef90_P78504
1,218
A0A2K6PBB4A0A2K6PBB4_RHIRODelta-like proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6PBB4
UniRef90_P78504
1,218
A0A2K6KMK3A0A2K6KMK3_RHIBEDelta-like proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6PBB4
UniRef90_P78504
1,218
A0A383YR28A0A383YR28_BALASDelta-like proteinBalaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni)310752UniRef100_A0A383YR28
UniRef90_P78504
1,218
A0A2Y9GZW5A0A2Y9GZW5_NEOSCDelta-like proteinNeomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A2Y9GZW5
UniRef90_P78504
1,218
A0A0D9RMJ0A0A0D9RMJ0_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RMJ0
UniRef90_P78504
1,218
U3BFZ9U3BFZ9_CALJADelta-like proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3BFZ9
UniRef90_P78504
1,218

Sequence

Representative sequenceiLengthMass (Da)Tools
P78504

Checksumi: F36EE9FBF64DF162

FASTA1,218133,798
        10         20         30         40         50
MRSPRTRGRS GRPLSLLLAL LCALRAKVCG ASGQFELEIL SMQNVNGELQ
60 70 80 90 100
NGNCCGGARN PGDRKCTRDE CDTYFKVCLK EYQSRVTAGG PCSFGSGSTP
110 120 130 140 150
VIGGNTFNLK ASRGNDRNRI VLPFSFAWPR SYTLLVEAWD SSNDTVQPDS
160 170 180 190 200
IIEKASHSGM INPSRQWQTL KQNTGVAHFE YQIRVTCDDY YYGFGCNKFC
210 220 230 240 250
RPRDDFFGHY ACDQNGNKTC MEGWMGPECN RAICRQGCSP KHGSCKLPGD
260 270 280 290 300
CRCQYGWQGL YCDKCIPHPG CVHGICNEPW QCLCETNWGG QLCDKDLNYC
310 320 330 340 350
GTHQPCLNGG TCSNTGPDKY QCSCPEGYSG PNCEIAEHAC LSDPCHNRGS
360 370 380 390 400
CKETSLGFEC ECSPGWTGPT CSTNIDDCSP NNCSHGGTCQ DLVNGFKCVC
410 420 430 440 450
PPQWTGKTCQ LDANECEAKP CVNAKSCKNL IASYYCDCLP GWMGQNCDIN
460 470 480 490 500
INDCLGQCQN DASCRDLVNG YRCICPPGYA GDHCERDIDE CASNPCLNGG
510 520 530 540 550
HCQNEINRFQ CLCPTGFSGN LCQLDIDYCE PNPCQNGAQC YNRASDYFCK
560 570 580 590 600
CPEDYEGKNC SHLKDHCRTT PCEVIDSCTV AMASNDTPEG VRYISSNVCG
610 620 630 640 650
PHGKCKSQSG GKFTCDCNKG FTGTYCHENI NDCESNPCRN GGTCIDGVNS
660 670 680 690 700
YKCICSDGWE GAYCETNIND CSQNPCHNGG TCRDLVNDFY CDCKNGWKGK
710 720 730 740 750
TCHSRDSQCD EATCNNGGTC YDEGDAFKCM CPGGWEGTTC NIARNSSCLP
760 770 780 790 800
NPCHNGGTCV VNGESFTCVC KEGWEGPICA QNTNDCSPHP CYNSGTCVDG
810 820 830 840 850
DNWYRCECAP GFAGPDCRIN INECQSSPCA FGATCVDEIN GYRCVCPPGH
860 870 880 890 900
SGAKCQEVSG RPCITMGSVI PDGAKWDDDC NTCQCLNGRI ACSKVWCGPR
910 920 930 940 950
PCLLHKGHSE CPSGQSCIPI LDDQCFVHPC TGVGECRSSS LQPVKTKCTS
960 970 980 990 1000
DSYYQDNCAN ITFTFNKEMM SPGLTTEHIC SELRNLNILK NVSAEYSIYI
1010 1020 1030 1040 1050
ACEPSPSANN EIHVAISAED IRDDGNPIKE ITDKIIDLVS KRDGNSSLIA
1060 1070 1080 1090 1100
AVAEVRVQRR PLKNRTDFLV PLLSSVLTVA WICCLVTAFY WCLRKRRKPG
1110 1120 1130 1140 1150
SHTHSASEDN TTNNVREQLN QIKNPIEKHG ANTVPIKDYE NKNSKMSKIR
1160 1170 1180 1190 1200
THNSEVEEDD MDKHQQKARF AKQPAYTLVD REEKPPNGTP TKHPNWTNKQ
1210
DNRDLESAQS LNRMEYIV
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again