Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P97500-4 Isoform 4 of Myelin transcription factor 1-like protein n=4 Tax=Eutheria TaxID=9347 RepID=Isoform 4 of MYT1L_MOUSE MTKGNLTLLEKAIALETERAKAMREKMAMDAGRRDNLRSYEDQSPRQLAGEDRKSKSSDS HVKKPYYDPSRTEKRESKCPTPGCDGTGHVTGLYPHHRSLSGCPHKDRVPPEILAMHENV LKCPTPGCTGRGHVNSNRNSHRSLSGCPIAAAEKLAKAQEKHQSCDVSKSNQASDRVLRP MCFVKQLEIPQYGYRNNVPTTTPRSNLAKELEKYSKTSFEYNSYDNHTYGKRAIAPKVQT RDISPKGYDDAKRYCKNASPSSSTTSSYAPSSSSNLSCGGGSSASSTCSKSSFDYTHDME AAHMAATAILNLSTRCREMPQNLSTKPQDLCTARNPDMEVDENGTLDLSMNKQRPRDSCC PVLTPLEPMSPQQQAVMSSRCFQLSEGDCWDLPVDYTKMKPRRVDEDEPKEITPEDLDPF QEALEERRYPGEVTIPSPKPKYPQCKESKKDLITLSGCPLADKSIRSMLATSSQELKLPV QGPSAIDHLLMFSDFLN

Members

List component clusters with 100% or 90% identity.
1 to 4 of 4  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P97500-4Isoform 4 of MYT1L_MOUSE4Mus musculus (Mouse)10090UniRef100_P97500-4
UniRef90_P97500-4
497Representative
Q3TSN8Q3TSN8_MOUSEMYT1 domain-containing protein (Fragment)Mus musculus (Mouse)10090UniRef100_P97500-4
UniRef90_P97500-4
71
A0A3B3ISB6A0A3B3ISB6_HUMANMyelin transcription factor 1-like protein (Fragment)Homo sapiens (Human)9606UniRef100_A0A3B3ISB6
UniRef90_A0A3B3ISB6
505Seed
G3UBP9G3UBP9_LOXAFMyelin transcription factor 1 likeLoxodonta africana (African elephant)9785UniRef100_G3UBP9
UniRef90_G3UBP9
479

Sequence

Representative sequenceiLengthMass (Da)Tools
P97500-4

Checksumi: 21AA2D3F73328430

FASTA49755,245
        10         20         30         40         50
MTKGNLTLLE KAIALETERA KAMREKMAMD AGRRDNLRSY EDQSPRQLAG
60 70 80 90 100
EDRKSKSSDS HVKKPYYDPS RTEKRESKCP TPGCDGTGHV TGLYPHHRSL
110 120 130 140 150
SGCPHKDRVP PEILAMHENV LKCPTPGCTG RGHVNSNRNS HRSLSGCPIA
160 170 180 190 200
AAEKLAKAQE KHQSCDVSKS NQASDRVLRP MCFVKQLEIP QYGYRNNVPT
210 220 230 240 250
TTPRSNLAKE LEKYSKTSFE YNSYDNHTYG KRAIAPKVQT RDISPKGYDD
260 270 280 290 300
AKRYCKNASP SSSTTSSYAP SSSSNLSCGG GSSASSTCSK SSFDYTHDME
310 320 330 340 350
AAHMAATAIL NLSTRCREMP QNLSTKPQDL CTARNPDMEV DENGTLDLSM
360 370 380 390 400
NKQRPRDSCC PVLTPLEPMS PQQQAVMSSR CFQLSEGDCW DLPVDYTKMK
410 420 430 440 450
PRRVDEDEPK EITPEDLDPF QEALEERRYP GEVTIPSPKP KYPQCKESKK
460 470 480 490
DLITLSGCPL ADKSIRSMLA TSSQELKLPV QGPSAIDHLL MFSDFLN
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again