Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_P98170 E3 ubiquitin-protein ligase XIAP n=158 Tax=Amniota TaxID=32524 RepID=XIAP_HUMAN MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK CPMCYTVITFKQKIFMS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 158  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
P98170XIAP_HUMANE3 ubiquitin-protein ligase XIAPHomo sapiens (Human)9606UniRef100_P98170
UniRef90_P98170
497Representative
Q60989XIAP_MOUSEE3 ubiquitin-protein ligase XIAPMus musculus (Mouse)10090UniRef100_Q60989
UniRef90_Q60989
496
Q9R0I6XIAP_RATE3 ubiquitin-protein ligase XIAPRattus norvegicus (Rat)10116UniRef100_Q9R0I6
UniRef90_Q60989
496
Q95M72BIRC8_PANTRBaculoviral IAP repeat-containing protein 8Pan troglodytes (Chimpanzee)9598UniRef100_Q95M72
UniRef90_Q95M72
236
B1AKU2B1AKU2_HUMANE3 ubiquitin-protein ligase XIAP (Fragment)Homo sapiens (Human)9606UniRef100_P98170
UniRef90_P98170
156
A0A3Q7XNL9A0A3Q7XNL9_URSARE3 ubiquitin-protein ligase XIAP isoform X1Ursus arctos horribilis116960UniRef100_A0A3Q7XNL9
UniRef90_P98170
559
A0A3Q7WU04A0A3Q7WU04_URSARE3 ubiquitin-protein ligase XIAP isoform X2Ursus arctos horribilis116960UniRef100_A0A3Q7XNL9
UniRef90_P98170
497
B1MTJ9B1MTJ9_PLEMOBaculoviral IAP repeat-containing 4 (Predicted)Plecturocebus moloch (Dusky titi monkey) (Callicebus moloch)9523UniRef100_B1MTJ9
UniRef90_P98170
497
A0A2K5D584A0A2K5D584_AOTNARING-type domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5D584
UniRef90_P98170
497
G7NRC4G7NRC4_MACMUBaculoviral IAP repeat-containing protein 4Macaca mulatta (Rhesus macaque)9544UniRef100_G7NRC4
UniRef90_P98170
497
A0A384DMI6A0A384DMI6_URSMAE3 ubiquitin-protein ligase XIAPUrsus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_A0A384DMI6
UniRef90_P98170
497
A0A2K5KEE8A0A2K5KEE8_COLAPRING-type domain-containing proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5KEE8
UniRef90_P98170
497
A0A096NAP9A0A096NAP9_PAPANRING-type domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A096NAP9
UniRef90_P98170
497
A0A2Y9KM82A0A2Y9KM82_ENHLUE3 ubiquitin-protein ligase XIAPEnhydra lutris kenyoni391180UniRef100_A0A2Y9KM82
UniRef90_P98170
497
D2HJ47D2HJ47_AILMERING-type domain-containing protein (Fragment)Ailuropoda melanoleuca (Giant panda)9646UniRef100_D2HJ47
UniRef90_P98170
497
A0A2K5PJ06A0A2K5PJ06_CEBCARING-type domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5PJ06
UniRef90_P98170
497
A0A485PD16A0A485PD16_LYNPABaculoviral iap repeat-containingLynx pardinus (Iberian lynx) (Felis pardina)191816UniRef100_A0A485PD16
UniRef90_P98170
497
A0A2U3VXH3A0A2U3VXH3_ODOROE3 ubiquitin-protein ligase XIAP isoform X1Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3VXH3
UniRef90_P98170
497
B0KWH9B0KWH9_CALJABaculoviral IAP repeat-containing 4 (Predicted)Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_B0KWH9
UniRef90_P98170
497
B2R9R2B2R9R2_HUMANcDNA, FLJ94517, highly similar to Homo sapiens baculoviral IAP repeat-containing 4 (BIRC4), mRNAHomo sapiens (Human)9606UniRef100_B2R9R2
UniRef90_P98170
497
A0A2K6UMY7A0A2K6UMY7_SAIBBX-linked inhibitor of apoptosisSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6UMY7
UniRef90_P98170
497
A0A4U5R8V2A0A4U5R8V2_CAMDRRING-type domain-containing proteinCamelus dromedarius (Dromedary) (Arabian camel)9838UniRef100_A0A4U5R8V2
UniRef90_P98170
497
H9FTU3H9FTU3_MACMUBaculoviral IAP repeat-containing protein 4Macaca mulatta (Rhesus macaque)9544UniRef100_H9FTU3
UniRef90_P98170
497
A0A2K5LDZ2A0A2K5LDZ2_CERATRING-type domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_H9FTU3
UniRef90_P98170
497
A0A2K5X0F7A0A2K5X0F7_MACFARING-type domain-containing proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_H9FTU3
UniRef90_P98170
497

Sequence

Representative sequenceiLengthMass (Da)Tools
P98170

Checksumi: 9D394C16D45EB635

FASTA49756,685
        10         20         30         40         50
MTFNSFEGSK TCVPADINKE EEFVEEFNRL KTFANFPSGS PVSASTLARA
60 70 80 90 100
GFLYTGEGDT VRCFSCHAAV DRWQYGDSAV GRHRKVSPNC RFINGFYLEN
110 120 130 140 150
SATQSTNSGI QNGQYKVENY LGSRDHFALD RPSETHADYL LRTGQVVDIS
160 170 180 190 200
DTIYPRNPAM YSEEARLKSF QNWPDYAHLT PRELASAGLY YTGIGDQVQC
210 220 230 240 250
FCCGGKLKNW EPCDRAWSEH RRHFPNCFFV LGRNLNIRSE SDAVSSDRNF
260 270 280 290 300
PNSTNLPRNP SMADYEARIF TFGTWIYSVN KEQLARAGFY ALGEGDKVKC
310 320 330 340 350
FHCGGGLTDW KPSEDPWEQH AKWYPGCKYL LEQKGQEYIN NIHLTHSLEE
360 370 380 390 400
CLVRTTEKTP SLTRRIDDTI FQNPMVQEAI RMGFSFKDIK KIMEEKIQIS
410 420 430 440 450
GSNYKSLEVL VADLVNAQKD SMQDESSQTS LQKEISTEEQ LRRLQEEKLC
460 470 480 490
KICMDRNIAI VFVPCGHLVT CKQCAEAVDK CPMCYTVITF KQKIFMS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again