Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q00422 GA-binding protein alpha chain n=199 Tax=Euteleostomi TaxID=117571 RepID=GABPA_MOUSE MTKREAEELIEIEIDGTEKAECTEESIVEQTYTPAECVSQAIDINEPIGNLKKLLEPRLQ CSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVISYQGMEPKLNILEIVKTAETV EVVIDPDAHHAEAEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL GIPYDPIHWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVPPATPTTIKVINSSAKAAKVQRSP RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVIE CEQKKLARMQLHGIAQPVTAVALAATSLQADKEI

Members

List component clusters with 100% or 90% identity.
1 to 25 of 199  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q00422GABPA_MOUSEGA-binding protein alpha chainMus musculus (Mouse)10090UniRef100_Q00422
UniRef90_Q00422
454Representative
Q6WJ14Q6WJ14_MOUSEGA binding protein subunit alpha (Fragment)Mus musculus (Mouse)10090UniRef100_Q00422
UniRef90_Q00422
186
Q91YY8Q91YY8_MOUSEGabpa proteinMus musculus (Mouse)10090UniRef100_Q00422
UniRef90_Q00422
351
Q6HAA1Q6HAA1_MOUSEGA-binding protein alpha-subunitMus musculus (Mouse)10090UniRef100_Q6HAA1
UniRef90_Q00422
454
A0A1U7Q9L6A0A1U7Q9L6_MESAUGA-binding protein alpha chainMesocricetus auratus (Golden hamster)10036UniRef100_A0A1U7Q9L6
UniRef90_Q00422
454
A0A286XW33A0A286XW33_CAVPOUncharacterized proteinCavia porcellus (Guinea pig)10141UniRef100_A0A286XW33
UniRef90_Q00422
454
A0A250Y1D4A0A250Y1D4_CASCNGA-binding protein alpha chainCastor canadensis (American beaver)51338UniRef100_A0A250Y1D4
UniRef90_Q00422
454
D4ACQ9D4ACQ9_RATGA repeat binding protein, alpha (Predicted)Rattus norvegicus (Rat)10116UniRef100_D4ACQ9
UniRef90_Q00422
454
I3MC05I3MC05_ICTTRUncharacterized proteinIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179UniRef100_I3MC05
UniRef90_Q00422
454
A0A5E4BER5A0A5E4BER5_MARMOUncharacterized proteinMarmota monax (Woodchuck)9995UniRef100_I3MC05
UniRef90_Q00422
454
A0A1S3GCR0A0A1S3GCR0_DIPORGA-binding protein alpha chain isoform X1Dipodomys ordii (Ord's kangaroo rat)10020UniRef100_A0A1S3GCR0
UniRef90_Q00422
454
G1SRH8G1SRH8_RABITUncharacterized proteinOryctolagus cuniculus (Rabbit)9986UniRef100_G1SRH8
UniRef90_Q00422
454
A0A383YN01A0A383YN01_BALASGA-binding protein alpha chainBalaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni)310752UniRef100_A0A383YN01
UniRef90_Q0VC98
454
A0A341ADX6A0A341ADX6_9CETALOW QUALITY PROTEIN: GA-binding protein alpha chainNeophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_A0A341ADX6
UniRef90_Q0VC98
454
F7B0D2F7B0D2_HORSEGA binding protein transcription factor subunit alphaEquus caballus (Horse)9796UniRef100_F7B0D2
UniRef90_Q0VC98
454
K9K331K9K331_HORSEGA-binding protein alpha chain-like protein (Fragment)Equus caballus (Horse)9796UniRef100_F7B0D2
UniRef90_Q0VC98
370
A0A2U3V3A6A0A2U3V3A6_TURTRGA-binding protein alpha chainTursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739UniRef100_A0A2U3V3A6
UniRef90_Q0VC98
454
A0A2Y9F9G5A0A2Y9F9G5_PHYMCGA-binding protein alpha chainPhyseter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef100_A0A2U3V3A6
UniRef90_Q0VC98
454
A0A2Y9N5V2A0A2Y9N5V2_DELLEGA-binding protein alpha chainDelphinapterus leucas (Beluga whale)9749UniRef100_A0A2U3V3A6
UniRef90_Q0VC98
454
A0A340XYU4A0A340XYU4_LIPVEGA-binding protein alpha chainLipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A2U3V3A6
UniRef90_Q0VC98
454
A0A452EEP4A0A452EEP4_CAPHIUncharacterized proteinCapra hircus (Goat)9925UniRef100_A0A452EEP4
UniRef90_Q0VC98
454
G1PHK7G1PHK7_MYOLUUncharacterized proteinMyotis lucifugus (Little brown bat)59463UniRef100_G1PHK7
UniRef90_Q0VC98
454
Q0VC98Q0VC98_BOVINGA binding protein transcription factor subunit alphaBos taurus (Bovine)9913UniRef100_Q0VC98
UniRef90_Q0VC98
454
A0A4W2F084A0A4W2F084_BOBOXUncharacterized proteinBos indicus x Bos taurus (Hybrid cattle)30522UniRef100_Q0VC98
UniRef90_Q0VC98
454
L8IDM5L8IDM5_9CETAGA-binding protein alpha chain (Fragment)Bos mutus (wild yak)72004UniRef100_Q0VC98
UniRef90_Q0VC98
429

Sequence

Representative sequenceiLengthMass (Da)Tools
Q00422

Checksumi: 2CBC40B895563685

FASTA45451,344
        10         20         30         40         50
MTKREAEELI EIEIDGTEKA ECTEESIVEQ TYTPAECVSQ AIDINEPIGN
60 70 80 90 100
LKKLLEPRLQ CSLDAHEICL QDIQLDPDRS LFDQGVKTDG TVQLSVQVIS
110 120 130 140 150
YQGMEPKLNI LEIVKTAETV EVVIDPDAHH AEAEAHLVEE AQVITLDGTK
160 170 180 190 200
HITTISDETS EQVTRWAAAL EGYRKEQERL GIPYDPIHWS TDQVLHWVVW
210 220 230 240 250
VMKEFSMTDI DLTTLNISGR ELCSLNQEDF FQRVPRGEIL WSHLELLRKY
260 270 280 290 300
VLASQEQQMN EIVTIDQPVQ IIPASVPPAT PTTIKVINSS AKAAKVQRSP
310 320 330 340 350
RISGEDRSSP GNRTGNNGQI QLWQFLLELL TDKDARDCIS WVGDEGEFKL
360 370 380 390 400
NQPELVAQKW GQRKNKPTMN YEKLSRALRY YYDGDMICKV QGKRFVYKFV
410 420 430 440 450
CDLKTLIGYS AAELNRLVIE CEQKKLARMQ LHGIAQPVTA VALAATSLQA

DKEI
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again