Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q02223 Tumor necrosis factor receptor superfamily member 17 n=38 Tax=Boreoeutheria TaxID=1437010 RepID=TNR17_HUMAN MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNAILWTCL GLSLIISLAVFVLMFLLRKINSEPLKDEFKNTGSGLLGMANIDLEKSRTGDEIILPRGLE YTVEECTCEDCIKSKPKVDSDHCFPLPAMEEGATILVTTKTNDYCKSLPAALSATEIEKS ISAR

Members

List component clusters with 100% or 90% identity.
1 to 25 of 38  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q02223TNR17_HUMANTumor necrosis factor receptor superfamily member 17Homo sapiens (Human)9606UniRef100_Q02223
UniRef90_Q02223
184Representative
H2NQ65H2NQ65_PONABBCMA-Tall_bind domain-containing proteinPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NQ65
UniRef90_Q02223
195
A0A2J8RUT4A0A2J8RUT4_PONABTNFRSF17 isoform 1 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_H2NQ65
UniRef90_Q02223
185
Q6PE46Q6PE46_HUMANTumor necrosis factor receptor superfamily, member 17Homo sapiens (Human)9606UniRef100_Q6PE46
UniRef90_Q02223
184
G3SBZ7G3SBZ7_GORGOTNF receptor superfamily member 17Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3SBZ7
UniRef90_Q02223
184
H2QAL5H2QAL5_PANTRTNF receptor superfamily member 17Pan troglodytes (Chimpanzee)9598UniRef100_H2QAL5
UniRef90_Q02223
184
A0A2R9B7E5A0A2R9B7E5_PANPABCMA-Tall_bind domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9B7E5
UniRef90_Q02223
184
A0A2I3G2V7A0A2I3G2V7_NOMLEBCMA-Tall_bind domain-containing proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3G2V7
UniRef90_Q02223
183
L5KQA5L5KQA5_PTEALTumor necrosis factor receptor superfamily member 17Pteropus alecto (Black flying fox)9402UniRef100_L5KQA5
UniRef90_L5KQA5
232Seed
F7E4Q1F7E4Q1_HORSETNF receptor superfamily member 17Equus caballus (Horse)9796UniRef100_F7E4Q1
UniRef90_F7E4Q1
175
K9IQT5K9IQT5_DESROPutative tumor necrosis factor receptor superfamily member 17-like protein (Fragment)Desmodus rotundus (Vampire bat)9430UniRef100_K9IQT5
UniRef90_K9IQT5
199
A0A3Q7XEW0A0A3Q7XEW0_URSARtumor necrosis factor receptor superfamily member 17 isoform X1Ursus arctos horribilis116960UniRef100_A0A3Q7XEW0
UniRef90_M3YST2
210
A0A384CL15A0A384CL15_URSMAtumor necrosis factor receptor superfamily member 17Ursus maritimus (Polar bear) (Thalarctos maritimus)29073UniRef100_A0A3Q7XEW0
UniRef90_M3YST2
175
A0A3Q7WTC2A0A3Q7WTC2_URSARtumor necrosis factor receptor superfamily member 17 isoform X2Ursus arctos horribilis116960UniRef100_A0A3Q7XEW0
UniRef90_M3YST2
175
G1LSQ3G1LSQ3_AILMETNF receptor superfamily member 17Ailuropoda melanoleuca (Giant panda)9646UniRef100_G1LSQ3
UniRef90_M3YST2
185
A0A452QGE8A0A452QGE8_URSAMTNF receptor superfamily member 17Ursus americanus (American black bear) (Euarctos americanus)9643UniRef100_A0A452QGE8
UniRef90_M3YST2
178
D2HSM7D2HSM7_AILMEBCMA-Tall_bind domain-containing protein (Fragment)Ailuropoda melanoleuca (Giant panda)9646UniRef100_D2HSM7
UniRef90_M3YST2
176
A0A2Y9KGD3A0A2Y9KGD3_ENHLUtumor necrosis factor receptor superfamily member 17Enhydra lutris kenyoni391180UniRef100_A0A2Y9KGD3
UniRef90_M3YST2
175
M3YST2M3YST2_MUSPFBCMA-Tall_bind domain-containing proteinMustela putorius furo (European domestic ferret) (Mustela furo)9669UniRef100_M3YST2
UniRef90_M3YST2
175
G9KUF4G9KUF4_MUSPFTumor necrosis factor receptor superfamily member 17-like protein (Fragment)Mustela putorius furo (European domestic ferret) (Mustela furo)9669UniRef100_M3YST2
UniRef90_M3YST2
174
A0A3Q7TUD8A0A3Q7TUD8_VULVULOW QUALITY PROTEIN: tumor necrosis factor receptor superfamily member 17Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7TUD8
UniRef90_J9NXG8
187
E2R7V8E2R7V8_CANLFTNF receptor superfamily member 17Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_E2R7V8
UniRef90_J9NXG8
187
J9NXG8J9NXG8_CANLFTNF receptor superfamily member 17Canis lupus familiaris (Dog) (Canis familiaris)9615UniRef100_J9NXG8
UniRef90_J9NXG8
175
A0A2U3ZHM1A0A2U3ZHM1_ODOROtumor necrosis factor receptor superfamily member 17Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3ZHM1
UniRef90_A0A2U3ZHM1
175
A0A3Q7MVY4A0A3Q7MVY4_CALURtumor necrosis factor receptor superfamily member 17Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7MVY4
UniRef90_A0A2U3ZHM1
175

Sequence

Representative sequenceiLengthMass (Da)Tools
Q02223

Checksumi: B6D87B3685F66022

FASTA18420,165
        10         20         30         40         50
MLQMAGQCSQ NEYFDSLLHA CIPCQLRCSS NTPPLTCQRY CNASVTNSVK
60 70 80 90 100
GTNAILWTCL GLSLIISLAV FVLMFLLRKI NSEPLKDEFK NTGSGLLGMA
110 120 130 140 150
NIDLEKSRTG DEIILPRGLE YTVEECTCED CIKSKPKVDS DHCFPLPAME
160 170 180
EGATILVTTK TNDYCKSLPA ALSATEIEKS ISAR
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again