Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q05655-2 Isoform 2 of Protein kinase C delta type n=626 Tax=Eumetazoa TaxID=6072 RepID=Isoform 2 of KPCD_HUMAN MSPFLRIGLSNFDCGTCQACQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTF DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGRTEIWLELKPQGRMLMNAR YFLEMSDTKDMSEFENEGFFALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ ARSLRDSEHIFREGPVEIGLPCSTKNETRPPCVPTPGKREPQGISWDSPLDGSNKSAGPP EPEVSMRRTSLQLKLKIDDFILHKMLGKGSFGKVFLAEFKRTNQFFAIKALKKDVVLMDD DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR ATFYAAEVILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMLGDAKTNTFC GTPDYIAPEILLGQKYNHSVDWWSFGVLVYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR WLEREAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPYD CSNFDKEFLSEKPRLSFADRALINSMDQNMFSNFSFINPGMETLICS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 626  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q05655-2Isoform 2 of KPCD_HUMAN2, PKCdeltaVIIIHomo sapiens (Human)9606UniRef100_Q05655-2
UniRef90_Q05655-2
707Representative
Q02111KPCT_MOUSEProtein kinase C theta typeMus musculus (Mouse)10090UniRef100_Q02111
UniRef90_Q04759
707
Q9WTQ0KPCT_RATProtein kinase C theta typeRattus norvegicus (Rat)10116UniRef100_Q9WTQ0
UniRef90_Q04759
707
Q04759KPCT_HUMANProtein kinase C theta typeHomo sapiens (Human)9606UniRef100_Q04759
UniRef90_Q04759
706
A0A2K6U489A0A2K6U489_SAIBBProtein kinase CSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6U489
UniRef90_Q05655-2
720
A0A0P6JK15A0A0P6JK15_HETGAProtein kinase CHeterocephalus glaber (Naked mole rat)10181UniRef100_A0A0P6JK15
UniRef90_Q04759
706
A0A2I3SR38A0A2I3SR38_PANTRProtein kinase CPan troglodytes (Chimpanzee)9598UniRef100_A0A2I3SR38
UniRef90_Q04759
845Seed
A0A2I3SNQ3A0A2I3SNQ3_PANTRProtein kinase CPan troglodytes (Chimpanzee)9598UniRef100_A0A2I3SR38
UniRef90_Q04759
706
A0A2R9A580A0A2R9A580_PANPAProtein kinase CPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9A580
UniRef90_Q04759
758
A0A2R9A0W2A0A2R9A0W2_PANPAProtein kinase CPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9A580
UniRef90_Q04759
706
G3RCJ3G3RCJ3_GORGOProtein kinase CGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2R9A580
UniRef90_Q04759
706
A0A2I3MUY1A0A2I3MUY1_PAPANProtein kinase CPapio anubis (Olive baboon)9555UniRef100_A0A2I3MUY1
UniRef90_Q04759
753
A0A0D9RM39A0A0D9RM39_CHLSBProtein kinase CChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9RM39
UniRef90_Q04759
745
H9FX48H9FX48_MACMUProtein kinase CMacaca mulatta (Rhesus macaque)9544UniRef100_A0A0D9RM39
UniRef90_Q04759
706
A0A2K5YIL7A0A2K5YIL7_MANLEProtein kinase CMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A0D9RM39
UniRef90_Q04759
706
F7HC75F7HC75_MACMUProtein kinase CMacaca mulatta (Rhesus macaque)9544UniRef100_A0A0D9RM39
UniRef90_Q04759
663
G7N1J6G7N1J6_MACMUProtein kinase CMacaca mulatta (Rhesus macaque)9544UniRef100_G7N1J6
UniRef90_Q04759
739
G7PE62G7PE62_MACFAProtein kinase CMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7N1J6
UniRef90_Q04759
739
G1SY23G1SY23_RABITProtein kinase COryctolagus cuniculus (Rabbit)9986UniRef100_G1SY23
UniRef90_Q04759
731
A0A287AH32A0A287AH32_PIGProtein kinase CSus scrofa (Pig)9823UniRef100_A0A287AH32
UniRef90_Q04759
728
F1RUL3F1RUL3_PIGProtein kinase CSus scrofa (Pig)9823UniRef100_A0A287AH32
UniRef90_Q04759
706
A0A0B8RTC1A0A0B8RTC1_PIGProtein kinase CSus scrofa domesticus (domestic pig)9825UniRef100_A0A287AH32
UniRef90_Q04759
706
A0A287BIN7A0A287BIN7_PIGProtein kinase CSus scrofa (Pig)9823UniRef100_A0A287AH32
UniRef90_Q04759
576
A0A1U7U962A0A1U7U962_TARSYProtein kinase CTarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7U962
UniRef90_Q04759
726
A0A2Y9R9N1A0A2Y9R9N1_TRIMAProtein kinase CTrichechus manatus latirostris (Florida manatee)127582UniRef100_A0A2Y9R9N1
UniRef90_Q04759
720

Sequence

Representative sequenceiLengthMass (Da)Tools
Q05655-2

Checksumi: 7A16492116CD2880

FASTA70781,573
        10         20         30         40         50
MSPFLRIGLS NFDCGTCQAC QGEAVNPYCA VLVKEYVESE NGQMYIQKKP
60 70 80 90 100
TMYPPWDSTF DAHINKGRVM QIIVKGKNVD LISETTVELY SLAERCRKNN
110 120 130 140 150
GRTEIWLELK PQGRMLMNAR YFLEMSDTKD MSEFENEGFF ALHQRRGAIK
160 170 180 190 200
QAKVHHVKCH EFTATFFPQP TFCSVCHEFV WGLNKQGYQC RQCNAAIHKK
210 220 230 240 250
CIDKVIAKCT GSAINSRETM FHKERFKIDM PHRFKVYNYK SPTFCEHCGT
260 270 280 290 300
LLWGLARQGL KCDACGMNVH HRCQTKVANL CGINQKLMAE ALAMIESTQQ
310 320 330 340 350
ARSLRDSEHI FREGPVEIGL PCSTKNETRP PCVPTPGKRE PQGISWDSPL
360 370 380 390 400
DGSNKSAGPP EPEVSMRRTS LQLKLKIDDF ILHKMLGKGS FGKVFLAEFK
410 420 430 440 450
RTNQFFAIKA LKKDVVLMDD DVECTMVEKR VLSLAWEHPF LTHMFCTFQT
460 470 480 490 500
KENLFFVMEY LNGGDLMYHI QSCHKFDLSR ATFYAAEVIL GLQFLHSKGI
510 520 530 540 550
VYRDLKLDNI LLDRDGHIKI ADFGMCKENM LGDAKTNTFC GTPDYIAPEI
560 570 580 590 600
LLGQKYNHSV DWWSFGVLVY EMLIGQSPFH GQDEEELFHS IRMDNPFYPR
610 620 630 640 650
WLEREAKDLL VKLFVREPEK RLGVRGDIRQ HPLFREINWE ELERKEIDPP
660 670 680 690 700
FRPKVKSPYD CSNFDKEFLS EKPRLSFADR ALINSMDQNM FSNFSFINPG

METLICS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again