Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q06734 Argininosuccinate synthase n=7188 RepID=ASSY_STRLA MSKVLTSLPAGERVGIAFSGGLDTSVAVAWMRDKGAVPCTYTADIGQYDEPDIASVPSRA SAYGAEITRLVDCRAALVEEGLAALACGAFHIRSGGRPYFNTTPLGRAVTGTLLVRAMLE DGVQIWGDGSTFKGNDIERFYRYGLLANPHLRIYKPWLDADFVTELGGRKEMSEWLLAHG LPYRDSTEKAYSTDANIWGATHEAKTLEHLDTGIETVDPIMGVRFWDPSVEIATEDVTVG FEQGRPVSINGKEFASAVDLVMEANAIGGRHGLGMSDQIENRIIEAKSRGIYEAPGMALL HIVYERLVNAIHNEDTLAAYHNEGRRLGRLMYEGRWLDPQALMIRESLQRWVGTAVTGEV TLRLRRGEDYSILDTTGPAFSYHPDKLSMERTEDSAFGPVDRIGQLTMRNLDIADSRARL EQYVGLGLVGTPHPTPIGAAQAAATGLIGAMDEGGAEAIASRGEATDEETMLDRAAMESG TD

Members

List component clusters with 100% or 90% identity.
1 to 25 of 7,188  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q06734ASSY_STRLAArgininosuccinate synthaseStreptomyces lavendulae1914UniRef100_Q06734
UniRef90_Q06734
482Representative
C1A3S5ASSY_GEMATArgininosuccinate synthaseGemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505)379066UniRef100_C1A3S5
UniRef90_C1A3S5
445
A9MP33ASSY_SALARArgininosuccinate synthaseSalmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980)41514UniRef100_A9MP33
UniRef90_Q8Z3H5
449
P0C1A1ASSY_DICD3Argininosuccinate synthaseDickeya dadantii (strain 3937) (Erwinia chrysanthemi (strain 3937))198628UniRef100_P0C1A1
UniRef90_Q8Z3H5
449
P55744ASSY_PECPMArgininosuccinate synthasePectobacterium parmentieri1905730UniRef100_P55744
UniRef90_Q8Z3H5
448
A4WEY6ASSY_ENT38Argininosuccinate synthaseEnterobacter sp. (strain 638)399742UniRef100_A4WEY6
UniRef90_Q8Z3H5
448
Q6DAZ8ASSY_PECASArgininosuccinate synthasePectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) (Erwinia carotovora subsp. atroseptica)218491UniRef100_Q6DAZ8
UniRef90_Q8Z3H5
448
C6DIG9ASSY_PECCPArgininosuccinate synthasePectobacterium carotovorum subsp. carotovorum (strain PC1)561230UniRef100_C6DIG9
UniRef90_Q8Z3H5
448
A8AQ63ASSY_CITK8Argininosuccinate synthaseCitrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)290338UniRef100_A8AQ63
UniRef90_Q8Z3H5
447
B5F6U1ASSY_SALA4Argininosuccinate synthaseSalmonella agona (strain SL483)454166UniRef100_B5F6U1
UniRef90_Q8Z3H5
447
B5QZW1ASSY_SALEPArgininosuccinate synthaseSalmonella enteritidis PT4 (strain P125109)550537UniRef100_B5F6U1
UniRef90_Q8Z3H5
447
B5XSX1ASSY_KLEP3Argininosuccinate synthaseKlebsiella pneumoniae (strain 342)507522UniRef100_B5XSX1
UniRef90_Q8Z3H5
447
B5FI16ASSY_SALDCArgininosuccinate synthaseSalmonella dublin (strain CT_02021853)439851UniRef100_B5FI16
UniRef90_Q8Z3H5
447
Q8Z3H5ASSY_SALTIArgininosuccinate synthaseSalmonella typhi90370UniRef100_Q8Z3H5
UniRef90_Q8Z3H5
447
B7MB92ASSY_ECO45Argininosuccinate synthaseEscherichia coli O45:K1 (strain S88 / ExPEC)585035UniRef100_B7MB92
UniRef90_Q8Z3H5
447
A1AG76ASSY_ECOK1Argininosuccinate synthaseEscherichia coli O1:K1 / APEC405955UniRef100_B7MB92
UniRef90_Q8Z3H5
447
Q1R6G5ASSY_ECOUTArgininosuccinate synthaseEscherichia coli (strain UTI89 / UPEC)364106UniRef100_B7MB92
UniRef90_Q8Z3H5
447
Q0T0B0ASSY_SHIF8Argininosuccinate synthaseShigella flexneri serotype 5b (strain 8401)373384UniRef100_Q0T0B0
UniRef90_Q8Z3H5
447
P59609ASSY_SHIFLArgininosuccinate synthaseShigella flexneri623UniRef100_Q0T0B0
UniRef90_Q8Z3H5
447
B2U204ASSY_SHIB3Argininosuccinate synthaseShigella boydii serotype 18 (strain CDC 3083-94 / BS512)344609UniRef100_B2U204
UniRef90_Q8Z3H5
447
Q31W50ASSY_SHIBSArgininosuccinate synthaseShigella boydii serotype 4 (strain Sb227)300268UniRef100_B2U204
UniRef90_Q8Z3H5
447
B7NKP0ASSY_ECO7IArgininosuccinate synthaseEscherichia coli O7:K1 (strain IAI39 / ExPEC)585057UniRef100_B7NKP0
UniRef90_Q8Z3H5
447
B7N0V6ASSY_ECO81Argininosuccinate synthaseEscherichia coli O81 (strain ED1a)585397UniRef100_B7NKP0
UniRef90_Q8Z3H5
447
C4ZSR2ASSY_ECOBWArgininosuccinate synthaseEscherichia coli (strain K12 / MC4100 / BW2952)595496UniRef100_B7NKP0
UniRef90_Q8Z3H5
447
B1XGY3ASSY_ECODHArgininosuccinate synthaseEscherichia coli (strain K12 / DH10B)316385UniRef100_B7NKP0
UniRef90_Q8Z3H5
447

Sequence

Representative sequenceiLengthMass (Da)Tools
Q06734

Checksumi: BFD58A4461B2137B

FASTA48252,383
        10         20         30         40         50
MSKVLTSLPA GERVGIAFSG GLDTSVAVAW MRDKGAVPCT YTADIGQYDE
60 70 80 90 100
PDIASVPSRA SAYGAEITRL VDCRAALVEE GLAALACGAF HIRSGGRPYF
110 120 130 140 150
NTTPLGRAVT GTLLVRAMLE DGVQIWGDGS TFKGNDIERF YRYGLLANPH
160 170 180 190 200
LRIYKPWLDA DFVTELGGRK EMSEWLLAHG LPYRDSTEKA YSTDANIWGA
210 220 230 240 250
THEAKTLEHL DTGIETVDPI MGVRFWDPSV EIATEDVTVG FEQGRPVSIN
260 270 280 290 300
GKEFASAVDL VMEANAIGGR HGLGMSDQIE NRIIEAKSRG IYEAPGMALL
310 320 330 340 350
HIVYERLVNA IHNEDTLAAY HNEGRRLGRL MYEGRWLDPQ ALMIRESLQR
360 370 380 390 400
WVGTAVTGEV TLRLRRGEDY SILDTTGPAF SYHPDKLSME RTEDSAFGPV
410 420 430 440 450
DRIGQLTMRN LDIADSRARL EQYVGLGLVG TPHPTPIGAA QAAATGLIGA
460 470 480
MDEGGAEAIA SRGEATDEET MLDRAAMESG TD
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again