Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q13309 S-phase kinase-associated protein 2 n=322 Tax=Euteleostomi TaxID=117571 RepID=SKP2_HUMAN MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK PSCL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 322  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q13309SKP2_HUMANS-phase kinase-associated protein 2Homo sapiens (Human)9606UniRef100_Q13309
UniRef90_Q13309
424Representative
Q9Z0Z3SKP2_MOUSES-phase kinase-associated protein 2Mus musculus (Mouse)10090UniRef100_Q9Z0Z3
UniRef90_Q9Z0Z3
424
A0A0A0MTL5A0A0A0MTL5_HUMANS-phase kinase-associated protein 2Homo sapiens (Human)9606UniRef100_Q13309
UniRef90_Q13309
435
A0A024R069A0A024R069_HUMANS-phase kinase-associated protein 2 (P45), isoform CRA_cHomo sapiens (Human)9606UniRef100_Q13309
UniRef90_Q13309
424
A0A2I3RFB4A0A2I3RFB4_PANTRS-phase kinase associated protein 2Pan troglodytes (Chimpanzee)9598UniRef100_Q13309
UniRef90_Q13309
424
A0A2R8ZQR3A0A2R8ZQR3_PANPAF-box domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R8ZQR3
UniRef90_Q13309
437
A0A1D5RH93A0A1D5RH93_MACMUF-box domain-containing proteinMacaca mulatta (Rhesus macaque)9544UniRef100_A0A1D5RH93
UniRef90_Q13309
437
A0A2K5M7E7A0A2K5M7E7_CERATF-box domain-containing proteinCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5M7E7
UniRef90_Q13309
437
A0A2K5CRI7A0A2K5CRI7_AOTNAF-box domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5CRI7
UniRef90_Q13309
435
H2QQS0H2QQS0_PANTRS-phase kinase associated protein 2Pan troglodytes (Chimpanzee)9598UniRef100_H2QQS0
UniRef90_Q13309
425
A0A2R8ZWK8A0A2R8ZWK8_PANPAF-box domain-containing proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_H2QQS0
UniRef90_Q13309
425
G3RHW0G3RHW0_GORGOS-phase kinase associated protein 2Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RHW0
UniRef90_Q13309
425
A0A2K5R5I8A0A2K5R5I8_CEBCAF-box domain-containing proteinCebus capucinus imitator1737458UniRef100_A0A2K5R5I8
UniRef90_Q13309
424
A0A2K5ELA0A0A2K5ELA0_AOTNAF-box domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5ELA0
UniRef90_Q13309
414
A0A2K5ELC9A0A2K5ELC9_AOTNAF-box domain-containing proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5ELC9
UniRef90_Q13309
412
B4DHK6B4DHK6_HUMANcDNA FLJ53740, highly similar to S-phase kinase-associated protein 2Homo sapiens (Human)9606UniRef100_B4DHK6
UniRef90_Q13309
390
F6TZR9F6TZR9_CALJAF-box domain-containing proteinCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F6TZR9
UniRef90_Q13309
384
W5PVK7W5PVK7_SHEEPF-box domain-containing proteinOvis aries (Sheep)9940UniRef100_W5PVK7
UniRef90_W5PVK7
479
A0A151MX07A0A151MX07_ALLMIS-phase kinase-associated protein 2Alligator mississippiensis (American alligator)8496UniRef100_A0A151MX07
UniRef90_A0A151MX07
419
A0A1U7SHG1A0A1U7SHG1_ALLSIS-phase kinase-associated protein 2Alligator sinensis (Chinese alligator)38654UniRef100_A0A1U7SHG1
UniRef90_A0A151MX07
418
A0A4X2L3Y0A0A4X2L3Y0_VOMURF-box domain-containing proteinVombatus ursinus (Common wombat)29139UniRef100_A0A4X2L3Y0
UniRef90_G3VP97
361
G3VP97G3VP97_SARHAF-box domain-containing proteinSarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius)9305UniRef100_G3VP97
UniRef90_G3VP97
420
F7FK00F7FK00_MONDOF-box domain-containing proteinMonodelphis domestica (Gray short-tailed opossum)13616UniRef100_F7FK00
UniRef90_F7FK00
422
A0A226NGD8A0A226NGD8_CALSUF-box domain-containing proteinCallipepla squamata (Scaled quail)9009UniRef100_A0A226NGD8
UniRef90_A0A226NGD8
428
A0A3Q7NY92A0A3Q7NY92_CALURS-phase kinase-associated protein 2 isoform X4Callorhinus ursinus (Northern fur seal)34884UniRef100_A0A3Q7NY92
UniRef90_F1PS69
400

Sequence

Representative sequenceiLengthMass (Da)Tools
Q13309

Checksumi: F29B7C338A7A37E9

FASTA42447,761
        10         20         30         40         50
MHRKHLQEIP DLSSNVATSF TWGWDSSKTS ELLSGMGVSA LEKEEPDSEN
60 70 80 90 100
IPQELLSNLG HPESPPRKRL KSKGSDKDFV IVRRPKLNRE NFPGVSWDSL
110 120 130 140 150
PDELLLGIFS CLCLPELLKV SGVCKRWYRL ASDESLWQTL DLTGKNLHPD
160 170 180 190 200
VTGRLLSQGV IAFRCPRSFM DQPLAEHFSP FRVQHMDLSN SVIEVSTLHG
210 220 230 240 250
ILSQCSKLQN LSLEGLRLSD PIVNTLAKNS NLVRLNLSGC SGFSEFALQT
260 270 280 290 300
LLSSCSRLDE LNLSWCFDFT EKHVQVAVAH VSETITQLNL SGYRKNLQKS
310 320 330 340 350
DLSTLVRRCP NLVHLDLSDS VMLKNDCFQE FFQLNYLQHL SLSRCYDIIP
360 370 380 390 400
ETLLELGEIP TLKTLQVFGI VPDGTLQLLK EALPHLQINC SHFTTIARPT
410 420
IGNKKNQEIW GIKCRLTLQK PSCL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again