Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q14186 Transcription factor Dp-1 n=915 Tax=Gnathostomata TaxID=7776 RepID=TFDP1_HUMAN MAKDAGLIEANGELKVFIDQNLSPGKGVVSLVAVHPSTVNPLGKQLLPKTFGQSNVNIAQ QVVIGTPQRPAASNTLVVGSPHTPSTHFASQNQPSDSSPWSAGKRNRKGEKNGKGLRHFS MKVCEKVQRKGTTSYNEVADELVAEFSAADNHILPNESAYDQKNIRRRVYDALNVLMAMN IISKEKKEIKWIGLPTNSAQECQNLEVERQRRLERIKQKQSQLQELILQQIAFKNLVQRN RHAEQQASRPPPPNSVIHLPFIIVNTSKKTVIDCSISNDKFEYLFNFDNTFEIHDDIEVL KRMGMACGLESGSCSAEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTAGSTSNGTRFS ASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDEDD

Members

List component clusters with 100% or 90% identity.
1 to 25 of 915  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q14186TFDP1_HUMANTranscription factor Dp-1Homo sapiens (Human)9606UniRef100_Q14186
UniRef90_Q14186
410Representative
Q08639TFDP1_MOUSETranscription factor Dp-1Mus musculus (Mouse)10090UniRef100_Q08639
UniRef90_Q14186
410
Q17QZ4TFDP1_BOVINTranscription factor Dp-1Bos taurus (Bovine)9913UniRef100_Q17QZ4
UniRef90_Q14186
410
Q64163TFDP2_MOUSETranscription factor Dp-2Mus musculus (Mouse)10090UniRef100_Q64163
UniRef90_Q64163
446
Q14188TFDP2_HUMANTranscription factor Dp-2Homo sapiens (Human)9606UniRef100_Q14188
UniRef90_Q14188
446
A0A024RDY4A0A024RDY4_HUMANTranscription factorHomo sapiens (Human)9606UniRef100_Q14186
UniRef90_Q14186
410
H2PXM3H2PXM3_PONABTranscription factorPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q14186
UniRef90_Q14186
410
G2HIH2G2HIH2_PANTRTranscription factorPan troglodytes (Chimpanzee)9598UniRef100_Q14186
UniRef90_Q14186
410
H9FZ21H9FZ21_MACMUTranscription factorMacaca mulatta (Rhesus macaque)9544UniRef100_Q14186
UniRef90_Q14186
410
A0A2K5NPP0A0A2K5NPP0_CERATTranscription factorCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_Q14186
UniRef90_Q14186
410
A0A096N2L4A0A096N2L4_PAPANTranscription factorPapio anubis (Olive baboon)9555UniRef100_Q14186
UniRef90_Q14186
410
A0A2R9AK90A0A2R9AK90_PANPATranscription factorPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_Q14186
UniRef90_Q14186
410
A0A2K5Y9H2A0A2K5Y9H2_MANLETranscription factorMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_Q14186
UniRef90_Q14186
410
A0A2I2Z015A0A2I2Z015_GORGOTranscription factorGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_Q14186
UniRef90_Q14186
410
A0A2K5V9M3A0A2K5V9M3_MACFATranscription factorMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_Q14186
UniRef90_Q14186
410
A0A2K6E9V4A0A2K6E9V4_MACNETranscription factorMacaca nemestrina (Pig-tailed macaque)9545UniRef100_Q14186
UniRef90_Q14186
410
A0A452QPX2A0A452QPX2_URSAMTranscription factor Dp-1Ursus americanus (American black bear) (Euarctos americanus)9643UniRef100_A0A452QPX2
UniRef90_Q14186
477
A0A2K5NQ49A0A2K5NQ49_CERATTranscription factorCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5NQ49
UniRef90_Q14186
417
A0A1A6HQD2A0A1A6HQD2_NEOLEUncharacterized protein (Fragment)Neotoma lepida (Desert woodrat)56216UniRef100_A0A1A6HQD2
UniRef90_Q14186
413
A0A2K6U5N4A0A2K6U5N4_SAIBBTranscription factorSaimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_A0A2K6U5N4
UniRef90_Q14186
411
A0A2K5QKB9A0A2K5QKB9_CEBCATranscription factorCebus capucinus imitator1737458UniRef100_A0A2K5QKB9
UniRef90_Q14186
411
A0A2I0MSV1A0A2I0MSV1_COLLITranscription factorColumba livia (Rock dove)8932UniRef100_A0A2I0MSV1
UniRef90_Q14186
411
A0A1V4J3N6A0A1V4J3N6_PATFATranscription factorPatagioenas fasciata monilis372326UniRef100_A0A2I0MSV1
UniRef90_Q14186
411
A0A1U7RG02A0A1U7RG02_ALLSITranscription factorAlligator sinensis (Chinese alligator)38654UniRef100_A0A1U7RG02
UniRef90_Q14186
411
A0A4X2K7U9A0A4X2K7U9_VOMURTranscription factorVombatus ursinus (Common wombat)29139UniRef100_A0A4X2K7U9
UniRef90_Q14186
411

Sequence

Representative sequenceiLengthMass (Da)Tools
Q14186

Checksumi: 3FEEFE1E49FD9ED0

FASTA41045,070
        10         20         30         40         50
MAKDAGLIEA NGELKVFIDQ NLSPGKGVVS LVAVHPSTVN PLGKQLLPKT
60 70 80 90 100
FGQSNVNIAQ QVVIGTPQRP AASNTLVVGS PHTPSTHFAS QNQPSDSSPW
110 120 130 140 150
SAGKRNRKGE KNGKGLRHFS MKVCEKVQRK GTTSYNEVAD ELVAEFSAAD
160 170 180 190 200
NHILPNESAY DQKNIRRRVY DALNVLMAMN IISKEKKEIK WIGLPTNSAQ
210 220 230 240 250
ECQNLEVERQ RRLERIKQKQ SQLQELILQQ IAFKNLVQRN RHAEQQASRP
260 270 280 290 300
PPPNSVIHLP FIIVNTSKKT VIDCSISNDK FEYLFNFDNT FEIHDDIEVL
310 320 330 340 350
KRMGMACGLE SGSCSAEDLK MARSLVPKAL EPYVTEMAQG TVGGVFITTA
360 370 380 390 400
GSTSNGTRFS ASDLTNGADG MLATSSNGSQ YSGSRVETPV SYVGEDDEED
410
DDFNENDEDD
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again