Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q15555-4 Isoform 4 of Microtubule-associated protein RP/EB family member 2 n=45 Tax=Amniota TaxID=32524 RepID=Isoform 4 of MARE2_HUMAN MARTTTTSSRIITGPSFLSGSTQCAGSVPTGAAYCQFMDMLFPGCISLKKVKFQAKLEHE YIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEAR QGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSA SKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRL MDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY

Members

List component clusters with 100% or 90% identity.
1 to 25 of 45  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q15555-4Isoform 4 of MARE2_HUMAN4Homo sapiens (Human)9606UniRef100_Q15555-4
UniRef90_Q15555-4
274Representative
A0A1U7TJ51A0A1U7TJ51_TARSYmicrotubule-associated protein RP/EB family member 2-like isoform X2Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7TJ51
UniRef90_Q15555-4
277Seed
A0A2K6GF75A0A2K6GF75_PROCOUncharacterized proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6GF75
UniRef90_Q15555-4
274
F6PL11F6PL11_CALJAMicrotubule associated protein RP/EB family member 2Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F6PL11
UniRef90_Q15555-4
274
A0A1U7T6Z4A0A1U7T6Z4_TARSYmicrotubule-associated protein RP/EB family member 2 isoform X5Tarsius syrichta (Philippine tarsier)1868482UniRef100_A0A1U7T6Z4
UniRef90_Q15555-4
274
A0A2I3N9H7A0A2I3N9H7_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3N9H7
UniRef90_Q15555-4
274
A0A2I3TJX7A0A2I3TJX7_PANTRMAPRE2 isoform 9Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3TJX7
UniRef90_Q15555-4
274
A0A2I3GFL2A0A2I3GFL2_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3TJX7
UniRef90_Q15555-4
274
A0A2I2YQH5A0A2I2YQH5_GORGOMicrotubule associated protein RP/EB family member 2Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I3TJX7
UniRef90_Q15555-4
274
A0A2Y9IZA0A0A2Y9IZA0_ENHLUmicrotubule-associated protein RP/EB family member 2 isoform X2Enhydra lutris kenyoni391180UniRef100_A0A2Y9IZA0
UniRef90_Q15555-4
273
A0A1S2ZL13A0A1S2ZL13_ERIEUmicrotubule-associated protein RP/EB family member 2 isoform X2Erinaceus europaeus (Western European hedgehog)9365UniRef100_A0A1S2ZL13
UniRef90_Q15555-4
273
A0A2Y9PHD8A0A2Y9PHD8_DELLEmicrotubule-associated protein RP/EB family member 2 isoform X3Delphinapterus leucas (Beluga whale)9749UniRef100_A0A2Y9PHD8
UniRef90_Q15555-4
273
M3WXE4M3WXE4_FELCAUncharacterized proteinFelis catus (Cat) (Felis silvestris catus)9685UniRef100_M3WXE4
UniRef90_Q15555-4
273
A0A2U3W858A0A2U3W858_ODOROmicrotubule-associated protein RP/EB family member 2 isoform X2Odobenus rosmarus divergens (Pacific walrus)9708UniRef100_A0A2U3W858
UniRef90_Q15555-4
273
A0A383YWS6A0A383YWS6_BALASmicrotubule-associated protein RP/EB family member 2 isoform X3Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni)310752UniRef100_A0A383YWS6
UniRef90_Q15555-4
273
A0A340X8A6A0A340X8A6_LIPVEmicrotubule-associated protein RP/EB family member 2 isoform X3Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A383YWS6
UniRef90_Q15555-4
273
G1PUP8G1PUP8_MYOLUMicrotubule associated protein RP/EB family member 2Myotis lucifugus (Little brown bat)59463UniRef100_G1PUP8
UniRef90_G1PUP8
246
A0A2K6GF79A0A2K6GF79_PROCOUncharacterized proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6GF79
UniRef90_G1PUP8
271
A0A093BXI6A0A093BXI6_TAUERMicrotubule-associated protein RP/EB family member 2 (Fragment)Tauraco erythrolophus (Red-crested turaco)121530UniRef100_A0A093BXI6
UniRef90_G1PUP8
218
A0A093I131A0A093I131_STRCAMicrotubule-associated protein RP/EB family member 2 (Fragment)Struthio camelus australis441894UniRef100_A0A093I131
UniRef90_A0A093I131
267
UPI0001D37EC8microtubule-associated protein RP/EB family member 2 isoform X4Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_UPI0001D37EC8
UniRef90_Q15555-4
274
UPI000533F382microtubule-associated protein RP/EB family member 2 isoform X4Saimiri boliviensis boliviensis (Bolivian squirrel monkey)39432UniRef100_UPI000533F382
UniRef90_Q15555-4
274
UPI00098AE715microtubule-associated protein RP/EB family member 2 isoform X6Microcebus murinus (Lesser mouse lemur) (Gray Mouse Lemur)30608UniRef100_UPI00098AE715
UniRef90_Q15555-4
274
UPI00045DC90Cmicrotubule-associated protein RP/EB family member 2 isoform X2Orycteropus afer afer1230840UniRef100_UPI00045DC90C
UniRef90_Q15555-4
273
UPI0003347143microtubule-associated protein RP/EB family member 2 isoform X3Condylura cristata (Star-nosed mole)143302UniRef100_UPI0003347143
UniRef90_Q15555-4
273

Sequence

Representative sequenceiLengthMass (Da)Tools
Q15555-4

Checksumi: 793DB6E775EBF28B

FASTA27430,691
        10         20         30         40         50
MARTTTTSSR IITGPSFLSG STQCAGSVPT GAAYCQFMDM LFPGCISLKK
60 70 80 90 100
VKFQAKLEHE YIHNFKLLQA SFKRMNVDKV IPVEKLVKGR FQDNLDFIQW
110 120 130 140 150
FKKFYDANYD GKEYDPVEAR QGQDAIPPPD PGEQIFNLPK KSHHANSPTA
160 170 180 190 200
GAAKSSPAAK PGSTPSRPSS AKRASSSGSA SKSDKDLETQ VIQLNEQVHS
210 220 230 240 250
LKLALEGVEK ERDFYFGKLR EIELLCQEHG QENDDLVQRL MDILYASEEH
260 270
EGHTEEPEAE EQAHEQQPPQ QEEY
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again