Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q3AW67 50S ribosomal protein L13 n=38 Tax=Bacteria TaxID=2 RepID=RL13_SYNS9 MNKTSLPPIDSIDRQWYVVDAENQTLGRLATEVASILRGKNNPNFTPHLDTGDFVVVVNA EKIQVSGKKPQQKLYRRHSGRPGGMKVETFESLQERIPERIVEKAIKGMLPHNALGRQMY RKLKVYKGTEHPHSAQKPQPLQLNPSATAK

Members

List component clusters with 100% or 90% identity.
1 to 25 of 38  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q3AW67RL13_SYNS950S ribosomal protein L13Synechococcus sp. (strain CC9902)316279UniRef100_Q3AW67
UniRef90_Q3AW67
150Representative
Q3AMQ6RL13_SYNSC50S ribosomal protein L13Synechococcus sp. (strain CC9605)110662UniRef100_Q3AMQ6
UniRef90_Q3AW67
150
Q7U4H5RL13_SYNPX50S ribosomal protein L13Synechococcus sp. (strain WH8102)84588UniRef100_Q7U4H5
UniRef90_Q3AW67
150
A0A076H613A0A076H613_9SYNE50S ribosomal protein L13Synechococcus sp. KORDI-49585423UniRef100_A0A076H613
UniRef90_Q3AW67
180
A0A2H4P2E2A0A2H4P2E2_9SYNE50S ribosomal protein L13Synechococcus sp. A15-1271050624UniRef100_A0A076H613
UniRef90_Q3AW67
150
A0A1Z9MEF6A0A1Z9MEF6_9SYNE50S ribosomal protein L13Synechococcus sp. TMED2051986598UniRef100_A0A076H613
UniRef90_Q3AW67
150
A0A076GWI6A0A076GWI6_9SYNE50S ribosomal protein L13Synechococcus sp. KORDI-1001280380UniRef100_A0A076GWI6
UniRef90_Q3AW67
150
A0A076HEI2A0A076HEI2_9SYNE50S ribosomal protein L13Synechococcus sp. KORDI-52585425UniRef100_A0A076HEI2
UniRef90_Q3AW67
150
A0A2H4P2G1A0A2H4P2G1_9SYNE50S ribosomal protein L13Synechococcus sp. A15-621050657UniRef100_A0A076HEI2
UniRef90_Q3AW67
150
A0A2H4P299A0A2H4P299_9SYNE50S ribosomal protein L13Synechococcus sp. A15-441050646UniRef100_A0A076HEI2
UniRef90_Q3AW67
150
A0A520LHW5A0A520LHW5_9SYNE50S ribosomal protein L13Synechococcus sp. MED-G1342518987UniRef100_A0A076HEI2
UniRef90_Q3AW67
150
Q060U7Q060U7_9SYNE50S ribosomal protein L13Synechococcus sp. BL107313625UniRef100_Q060U7
UniRef90_Q3AW67
150
W0GW50W0GW50_9SYNE50S ribosomal protein L13Synechococcus sp. WH 8109166314UniRef100_W0GW50
UniRef90_Q3AW67
150
A0A2H4P2D4A0A2H4P2D4_9SYNE50S ribosomal protein L13Synechococcus sp. PROS-U-11400866UniRef100_A0A2H4P2D4
UniRef90_Q3AW67
150
A0A520LM44A0A520LM44_9SYNE50S ribosomal protein L13Synechococcus sp. MED-G1332518986UniRef100_A0A520LM44
UniRef90_Q3AW67
150
A0A2H4P2B4A0A2H4P2B4_9SYNE50S ribosomal protein L13Synechococcus sp. A15-281050638UniRef100_A0A520LM44
UniRef90_Q3AW67
150
A0A2E1ILV0A0A2E1ILV0_9SYNE50S ribosomal protein L13Synechococcus sp. MED8502024883UniRef100_A0A2E1ILV0
UniRef90_Q3AW67
150
A0A1Z9PYJ4A0A1Z9PYJ4_9CYAN50S ribosomal protein L13Cyanobacteria bacterium TMED2291986679UniRef100_A0A2E1ILV0
UniRef90_Q3AW67
150
A0A2H4P2A9A0A2H4P2A9_9SYNE50S ribosomal protein L13Synechococcus sp. BOUM1181442552UniRef100_Q7U4H5
UniRef90_Q3AW67
150
A0A2H4P2C8A0A2H4P2C8_9SYNE50S ribosomal protein L13Synechococcus sp. A18-46.11866940UniRef100_Q7U4H5
UniRef90_Q3AW67
150
A0A2H4P2D1A0A2H4P2D1_9SYNE50S ribosomal protein L13Synechococcus sp. RS9915221358UniRef100_Q7U4H5
UniRef90_Q3AW67
150
A0A2H4P2C7A0A2H4P2C7_9SYNE50S ribosomal protein L13Synechococcus sp. A18-401866939UniRef100_Q7U4H5
UniRef90_Q3AW67
150
A0A0H5PVB4A0A0H5PVB4_SYNPZ50S ribosomal protein L13Synechococcus sp. (strain WH8103)29410UniRef100_Q7U4H5
UniRef90_Q3AW67
150
A0A2D6Y703A0A2D6Y703_9SYNE50S ribosomal protein L13Synechococcus sp. ARS10192024878UniRef100_A0A2D6Y703
UniRef90_Q3AW67
150
A0A2E1IN42A0A2E1IN42_9CYAN50S ribosomal protein L13Cyanobium sp. MED8432024871UniRef100_A0A2E1IN42
UniRef90_Q3AW67
150

Sequence

Representative sequenceiLengthMass (Da)Tools
Q3AW67

Checksumi: 16E0D4AF697AD38A

FASTA15016,918
        10         20         30         40         50
MNKTSLPPID SIDRQWYVVD AENQTLGRLA TEVASILRGK NNPNFTPHLD
60 70 80 90 100
TGDFVVVVNA EKIQVSGKKP QQKLYRRHSG RPGGMKVETF ESLQERIPER
110 120 130 140 150
IVEKAIKGML PHNALGRQMY RKLKVYKGTE HPHSAQKPQP LQLNPSATAK
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again