Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q44284 ORF n=5 Tax=Acetobacteraceae TaxID=433 RepID=Q44284_ACEPA MIAVAVAPFGLGHDPPAARPAVLCDPVKGGETARSSACRGGFVTNLSGQRGNPVIQAGVA CKPEQEVNVVVFAPCHQTVPGETAVPTHQDTHPGPTAPDLLHDPADVCQCFLPRVPVCRA QGSAEEMVPAEDIQGKIAVMAVISMKGAAFLMAMDTVIGGIHIQNDPGGCVLMLVKEERD EQGSQGLMISNDPTVTICLVPTALQPVQCRFASQCCAVCPAS

Members

List component clusters with 100% or 90% identity.
1 to 5 of 5  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q44284Q44284_ACEPAORFAcetobacter pasteurianus (Acetobacter turbidans)438UniRef100_Q44284
UniRef90_Q44284
222Representative & Seed
A0A0M0EBY7A0A0M0EBY7_KOMEUUncharacterized proteinKomagataeibacter europaeus (Gluconacetobacter europaeus)33995UniRef100_Q44284
UniRef90_Q44284
83
A0A401X9D1A0A401X9D1_ACEPAUncharacterized proteinAcetobacter pasteurianus NBRC 32781226660UniRef100_Q44284
UniRef90_Q44284
83
A0A0C9LHR6A0A0C9LHR6_9PROTUncharacterized protein (Fragment)Acetobacter tropicalis104102UniRef100_Q44284
UniRef90_Q44284
48
A0A0C9LLM3A0A0C9LLM3_9PROTUncharacterized protein (Fragment)Acetobacter tropicalis104102UniRef100_Q44284
UniRef90_Q44284
50

Sequence

Representative sequenceiLengthMass (Da)Tools
Q44284

Checksumi: 8F3FC796EAC94D9D

FASTA22223,015
        10         20         30         40         50
MIAVAVAPFG LGHDPPAARP AVLCDPVKGG ETARSSACRG GFVTNLSGQR
60 70 80 90 100
GNPVIQAGVA CKPEQEVNVV VFAPCHQTVP GETAVPTHQD THPGPTAPDL
110 120 130 140 150
LHDPADVCQC FLPRVPVCRA QGSAEEMVPA EDIQGKIAVM AVISMKGAAF
160 170 180 190 200
LMAMDTVIGG IHIQNDPGGC VLMLVKEERD EQGSQGLMIS NDPTVTICLV
210 220
PTALQPVQCR FASQCCAVCP AS
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again