Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q5SW28 Phosphoinositide 3-kinase regulatory subunit 5 n=253 Tax=Gnathostomata TaxID=7776 RepID=PI3R5_MOUSE MQPAATTCTEDRIQHALERCLHGLSLGRRSAPWSAGLCLNCWSLQELVSRDPGHFLILLE QILQKTQEVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAASTYHCFLTWPVPYC SICREMLTFIDAELKAPGISYQRLVRAEQGLPVRSHRSSTVTVLLLNPVEVQAEFLAVAD KLSTPGQSPHGTYTTLLLHAFQATFGAHCDLPKLHRKLQSKTIEELEDIFTETTEAQELA SGIGDVAEAREWLRTKLQAVGEKAGFPGILDTASPGKLHTIPIPVARCYTYSWNQDSFDI LQEVLLKEQELLQPGILGDDEEEEEEDLEMDRHCAERDSLLSTSSLVSHDSTLLLTSSQA SEPVLSRQMLTTFVSGLSDGMDSGYVEDSEENSEWPQKPGSQKRQGHRRPGQKFNRFYKL LKSTSQLVLRRDSRSLESSVDPTLPLRRAGSLCSPLDCPAQLPSRAQRSRSLPQAKLTTQ LPRWLLAPPSHHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSKLRRLETSHPI LTRFFKLQFFYVPVKRSHGTSPSACPSSLSQASPLPADSLKYPSPTDLGMAPWEDSTNDI SHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKADSRPLEGSATQLPILADMLLYYCRFAA RPVLLQVYQTELTFVTGEKTTEIFIQSLELGHSATTRAIKASGRGRKRLGIDDDREAVPL TLQIIYSKGAISGRSRWSNLEKVCTSVNLSKACQKPEELDSSMEALTLTLTEVVKRQNPK SKKGFNQISTSYIKVDKVQIIGSSSCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSSLP PERSFSQPAETGSDLCSLLCLPIMTFSGALP

Members

List component clusters with 100% or 90% identity.
1 to 25 of 253  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q5SW28PI3R5_MOUSEPhosphoinositide 3-kinase regulatory subunit 5Mus musculus (Mouse)10090UniRef100_Q5SW28
UniRef90_Q5SW28
871Representative
Q5ZIB8PIRK5_CHICKPhosphoinositide 3-kinase regulatory subunit 5Gallus gallus (Chicken)9031UniRef100_Q5ZIB8
UniRef90_Q5ZIB8
881
Q6INI0PI3R5_XENLAPhosphoinositide 3-kinase regulatory subunit 5Xenopus laevis (African clawed frog)8355UniRef100_Q6INI0
UniRef90_Q6INI0
879
A1A4T4A1A4T4_MOUSEPhosphoinositide-3-kinase, regulatory subunit 5, p101Mus musculus (Mouse)10090UniRef100_Q5SW28
UniRef90_Q5SW28
871
A0A3L7GMR8A0A3L7GMR8_CRIGRPIK3R5Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef100_A0A3L7GMR8
UniRef90_Q5SW28
890
A0A1U7QJY2A0A1U7QJY2_MESAUphosphoinositide 3-kinase regulatory subunit 5Mesocricetus auratus (Golden hamster)10036UniRef100_A0A1U7QJY2
UniRef90_Q5SW28
872
A0A1A6GMR5A0A1A6GMR5_NEOLEUncharacterized proteinNeotoma lepida (Desert woodrat)56216UniRef100_A0A1A6GMR5
UniRef90_Q5SW28
871
D4A4I3D4A4I3_RATPhosphoinositide-3-kinase, regulatory subunit 5Rattus norvegicus (Rat)10116UniRef100_D4A4I3
UniRef90_D4A4I3
872
M7AFT0M7AFT0_CHEMYPhosphoinositide 3-kinase regulatory subunit 5 (Fragment)Chelonia mydas (Green sea-turtle) (Chelonia agassizi)8469UniRef100_M7AFT0
UniRef90_A0A452HIU6
884
A0A4D9E4Q4A0A4D9E4Q4_9SAURBile acid receptorPlatysternon megacephalum (big-headed turtle)55544UniRef100_A0A4D9E4Q4
UniRef90_A0A452HIU6
883
A0A452HIU6A0A452HIU6_9SAURPhosphoinositide-3-kinase regulatory subunit 5Gopherus agassizii (Agassiz's desert tortoise)38772UniRef100_A0A452HIU6
UniRef90_A0A452HIU6
883
A0A093NBL3A0A093NBL3_PYGADPhosphoinositide 3-kinase regulatory subunit 5 (Fragment)Pygoscelis adeliae (Adelie penguin)9238UniRef100_A0A093NBL3
UniRef90_A0A093NBL3
125
U3K446U3K446_FICALPhosphoinositide-3-kinase regulatory subunit 5Ficedula albicollis (Collared flycatcher) (Muscicapa albicollis)59894UniRef100_U3K446
UniRef90_U3K446
873
F6QEW7F6QEW7_HORSEPhosphoinositide-3-kinase regulatory subunit 5Equus caballus (Horse)9796UniRef100_F6QEW7
UniRef90_F6QEW7
877
A0A4X1VAG6A0A4X1VAG6_PIGPhosphoinositide 3-kinase regulatory subunit 5Sus scrofa (Pig)9823UniRef100_A0A4X1VAG6
UniRef90_F6QEW7
877
A0A3L8RY91A0A3L8RY91_CHLGUUncharacterized proteinChloebia gouldiae (Gouldian finch) (Erythrura gouldiae)44316UniRef100_A0A3L8RY91
UniRef90_A0A3L8RY91
827
A0A383YUN0A0A383YUN0_BALASphosphoinositide 3-kinase regulatory subunit 5Balaenoptera acutorostrata scammoni (North Pacific minke whale) (Balaenoptera davidsoni)310752UniRef100_A0A383YUN0
UniRef90_A0A383YUN0
882
A0A091IDA4A0A091IDA4_CALANPhosphoinositide 3-kinase regulatory subunit 5 (Fragment)Calypte anna (Anna's hummingbird) (Archilochus anna)9244UniRef100_A0A091IDA4
UniRef90_A0A091IDA4
125
H3A3P7H3A3P7_LATCHUncharacterized proteinLatimeria chalumnae (Coelacanth)7897UniRef100_H3A3P7
UniRef90_H3A3P7
814
A0A401P8A6A0A401P8A6_SCYTOUncharacterized proteinScyliorhinus torazame (Cloudy catshark)75743UniRef100_A0A401P8A6
UniRef90_A0A401P8A6
867
A0A493TAQ2A0A493TAQ2_ANAPPPhosphoinositide-3-kinase regulatory subunit 5Anas platyrhynchos platyrhynchos (Northern mallard)8840UniRef100_A0A493TAQ2
UniRef90_A0A493TAQ2
808
A0A341BQY3A0A341BQY3_9CETALOW QUALITY PROTEIN: phosphoinositide 3-kinase regulatory subunit 5Neophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise)1706337UniRef100_A0A341BQY3
UniRef90_A0A2U4C2G1
874
A0A340XF94A0A340XF94_LIPVEphosphoinositide 3-kinase regulatory subunit 5Lipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A340XF94
UniRef90_A0A2U4C2G1
873
A0A2U4C2G1A0A2U4C2G1_TURTRphosphoinositide 3-kinase regulatory subunit 5Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739UniRef100_A0A2U4C2G1
UniRef90_A0A2U4C2G1
739
A0A087R8R3A0A087R8R3_APTFOPhosphoinositide 3-kinase regulatory subunit 5Aptenodytes forsteri (Emperor penguin)9233UniRef100_A0A087R8R3
UniRef90_A0A087R8R3
883

Sequence

Representative sequenceiLengthMass (Da)Tools
Q5SW28

Checksumi: 1D0F36A3D4042D62

FASTA87196,954
        10         20         30         40         50
MQPAATTCTE DRIQHALERC LHGLSLGRRS APWSAGLCLN CWSLQELVSR
60 70 80 90 100
DPGHFLILLE QILQKTQEVQ EKGTYDLLAP LALLFYSTVL CTPHFPPDSD
110 120 130 140 150
LLLKAASTYH CFLTWPVPYC SICREMLTFI DAELKAPGIS YQRLVRAEQG
160 170 180 190 200
LPVRSHRSST VTVLLLNPVE VQAEFLAVAD KLSTPGQSPH GTYTTLLLHA
210 220 230 240 250
FQATFGAHCD LPKLHRKLQS KTIEELEDIF TETTEAQELA SGIGDVAEAR
260 270 280 290 300
EWLRTKLQAV GEKAGFPGIL DTASPGKLHT IPIPVARCYT YSWNQDSFDI
310 320 330 340 350
LQEVLLKEQE LLQPGILGDD EEEEEEDLEM DRHCAERDSL LSTSSLVSHD
360 370 380 390 400
STLLLTSSQA SEPVLSRQML TTFVSGLSDG MDSGYVEDSE ENSEWPQKPG
410 420 430 440 450
SQKRQGHRRP GQKFNRFYKL LKSTSQLVLR RDSRSLESSV DPTLPLRRAG
460 470 480 490 500
SLCSPLDCPA QLPSRAQRSR SLPQAKLTTQ LPRWLLAPPS HHQRRRPFLS
510 520 530 540 550
GDEDPKASTL RVVVFGSDRI SGKVARAYSK LRRLETSHPI LTRFFKLQFF
560 570 580 590 600
YVPVKRSHGT SPSACPSSLS QASPLPADSL KYPSPTDLGM APWEDSTNDI
610 620 630 640 650
SHYLGMLDPW YERNVLGLMH LPPEVLCQQS LKADSRPLEG SATQLPILAD
660 670 680 690 700
MLLYYCRFAA RPVLLQVYQT ELTFVTGEKT TEIFIQSLEL GHSATTRAIK
710 720 730 740 750
ASGRGRKRLG IDDDREAVPL TLQIIYSKGA ISGRSRWSNL EKVCTSVNLS
760 770 780 790 800
KACQKPEELD SSMEALTLTL TEVVKRQNPK SKKGFNQIST SYIKVDKVQI
810 820 830 840 850
IGSSSCPFAV CLDQDERKIL QSVVRCEVSP CYKPEKSSLP PERSFSQPAE
860 870
TGSDLCSLLC LPIMTFSGAL P
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again