Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q64437 All-trans-retinol dehydrogenase [NAD(+)] ADH7 n=99 Tax=Tetrapoda TaxID=32523 RepID=ADH7_MOUSE MGTAGKVIKCKAAVLWGVNQPFSIEEIEVAPPKAKEVRVKILATGICRTDDHIIKGSMVS KFPVIVGHEAVGVVESVGEGVTTVRPGDKVIPLFLPQCRECNACLNPEGNLCIRSDLTGR GVLADGTTRFTCKGKPVQHFMNTSTFTEYTVLDESSVAKVDGAAPPEKACLIGCGFSTGY GAAVKTAKVTPGSTCVVFGLGGVGLSVIMGCKAAGASRIIGIDINKDKFQKALAVGATEC ISPKDSTKPISEVLSDMTGNTIQYTFEVIGRLETMVDALSSCHMNYGTSVVVGAPPSAKM LTYDPMLLFTGRTWKGCVFGGWKSRDDVPKLVTEFLEKKFDLDQLITHTLPFNNINEGFE LLYSGKSIRTVLTF

Members

List component clusters with 100% or 90% identity.
1 to 25 of 99  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q64437ADH7_MOUSEAll-trans-retinol dehydrogenase [NAD(+)] ADH7Mus musculus (Mouse)10090UniRef100_Q64437
UniRef90_Q64437
374Representative
P41682ADH7_RATAll-trans-retinol dehydrogenase [NAD(+)] ADH7Rattus norvegicus (Rat)10116UniRef100_P41682
UniRef90_Q64437
374
Q9D748Q9D748_MOUSEAlcohol dehydrogenase 7 (Class IV), mu or sigma polypeptideMus musculus (Mouse)10090UniRef100_Q64437
UniRef90_Q64437
374
Q8JZP4Q8JZP4_MOUSEAlcohol dehydrogenase 4 (Fragment)Mus musculus (Mouse)10090UniRef100_Q64437
UniRef90_Q64437
51
Q548K2Q548K2_MOUSEAlcohol dehydrogenase class 4Mus musculus (Mouse)10090UniRef100_Q548K2
UniRef90_Q64437
374
Q8JZP5Q8JZP5_MOUSEAlcohol dehydrogenase 4 (Fragment)Mus musculus (Mouse)10090UniRef100_Q548K2
UniRef90_Q64437
51
Q3UMM7Q3UMM7_MOUSEPKS_ER domain-containing proteinMus musculus (Mouse)10090UniRef100_Q3UMM7
UniRef90_Q64437
374
G3V7J9G3V7J9_RATAll-trans-retinol dehydrogenase [NAD(+)] ADH7Rattus norvegicus (Rat)10116UniRef100_G3V7J9
UniRef90_Q64437
374
A0A1A6HBI3A0A1A6HBI3_NEOLEUncharacterized proteinNeotoma lepida (Desert woodrat)56216UniRef100_A0A1A6HBI3
UniRef90_Q64437
357
A0A3L7ICZ9A0A3L7ICZ9_CRIGRADH7 (Fragment)Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)10029UniRef100_A0A3L7ICZ9
UniRef90_Q64437
354
R4GCE1R4GCE1_ANOCAAlcohol dehydrogenase 7AAnolis carolinensis (Green anole) (American chameleon)28377UniRef100_R4GCE1
UniRef90_R4GCE1
377
A0A5F8HFY7A0A5F8HFY7_MONDOAlcohol dehydrogenase 7 (class IV), mu or sigma polypeptideMonodelphis domestica (Gray short-tailed opossum)13616UniRef100_A0A5F8HFY7
UniRef90_F6V2C5
376
F6V2C5F6V2C5_MONDOAlcohol dehydrogenase 7 (class IV), mu or sigma polypeptideMonodelphis domestica (Gray short-tailed opossum)13616UniRef100_F6V2C5
UniRef90_F6V2C5
376
A0A5F8GZR2A0A5F8GZR2_MONDOAlcohol dehydrogenase 7 (class IV), mu or sigma polypeptideMonodelphis domestica (Gray short-tailed opossum)13616UniRef100_A0A5F8GZR2
UniRef90_F6V2C5
376
B4E2R9B4E2R9_HUMANcDNA FLJ52054, highly similar to Alcohol dehydrogenase 1BHomo sapiens (Human)9606UniRef100_B4E2R9
UniRef90_A0A2I3M1S1
298
A0A2I3M1S1A0A2I3M1S1_PAPANPKS_ER domain-containing proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3M1S1
UniRef90_A0A2I3M1S1
372
A0A340XRC6A0A340XRC6_LIPVELOW QUALITY PROTEIN: alcohol dehydrogenase class 4 mu/sigma chainLipotes vexillifer (Yangtze river dolphin)118797UniRef100_A0A340XRC6
UniRef90_A0A340XRC6
436
A0A5G3IKG0A0A5G3IKG0_XENTRProteasome 26S subunit, non-ATPase 12Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)8364UniRef100_A0A5G3IKG0
UniRef90_Q5BKM0
375
Q5BKM0Q5BKM0_XENTRAlcohol dehydrogenase 10AXenopus tropicalis (Western clawed frog) (Silurana tropicalis)8364UniRef100_Q5BKM0
UniRef90_Q5BKM0
376
G3VK23G3VK23_SARHAUncharacterized proteinSarcophilus harrisii (Tasmanian devil) (Sarcophilus laniarius)9305UniRef100_G3VK23
UniRef90_G3VK23
386
A0A4X2M178A0A4X2M178_VOMURUncharacterized proteinVombatus ursinus (Common wombat)29139UniRef100_A0A4X2M178
UniRef90_A0A4X2M178
374
A0A5E4B0Z2A0A5E4B0Z2_MARMOUncharacterized proteinMarmota monax (Woodchuck)9995UniRef100_A0A5E4B0Z2
UniRef90_A0A5E4B0Z2
374
A0A2Y9NSW7A0A2Y9NSW7_DELLELOW QUALITY PROTEIN: alcohol dehydrogenase class 4 mu/sigma chainDelphinapterus leucas (Beluga whale)9749UniRef100_A0A2Y9NSW7
UniRef90_A0A2Y9NSW7
378
A0A341ARN4A0A341ARN4_NEOAALOW QUALITY PROTEIN: alcohol dehydrogenase class 4 mu/sigma chainNeophocaena asiaeorientalis asiaeorientalis (Yangtze finless porpoise) (Neophocaena phocaenoides subsp. asiaeorientalis)1706337UniRef100_A0A341ARN4
UniRef90_A0A2Y9NSW7
377
A0A5F8HH99A0A5F8HH99_MONDOAlcohol dehydrogenase 7 (class IV), mu or sigma polypeptideMonodelphis domestica (Gray short-tailed opossum)13616UniRef100_A0A5F8HH99
UniRef90_F7BAV0
362

Sequence

Representative sequenceiLengthMass (Da)Tools
Q64437

Checksumi: D615119A23B41843

FASTA37439,904
        10         20         30         40         50
MGTAGKVIKC KAAVLWGVNQ PFSIEEIEVA PPKAKEVRVK ILATGICRTD
60 70 80 90 100
DHIIKGSMVS KFPVIVGHEA VGVVESVGEG VTTVRPGDKV IPLFLPQCRE
110 120 130 140 150
CNACLNPEGN LCIRSDLTGR GVLADGTTRF TCKGKPVQHF MNTSTFTEYT
160 170 180 190 200
VLDESSVAKV DGAAPPEKAC LIGCGFSTGY GAAVKTAKVT PGSTCVVFGL
210 220 230 240 250
GGVGLSVIMG CKAAGASRII GIDINKDKFQ KALAVGATEC ISPKDSTKPI
260 270 280 290 300
SEVLSDMTGN TIQYTFEVIG RLETMVDALS SCHMNYGTSV VVGAPPSAKM
310 320 330 340 350
LTYDPMLLFT GRTWKGCVFG GWKSRDDVPK LVTEFLEKKF DLDQLITHTL
360 370
PFNNINEGFE LLYSGKSIRT VLTF
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again