Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q68985 Secreted protein ORF2 n=7633 Tax=Hepeviridae TaxID=291484 RepID=CAPSD_HEVHY MGPRPILLLFLMFLPMLLAPPPGQPSGRRRGRRSGGSGGGFWGDRVDSQPFAIPYIHPTN PFAPNVTAAAGAGPRVRQPVRPLGSAWRDQAQRPAAASRRRPTTAGAAPLTAVAPAHDTP PVPDVDSRGAILRRQYNLSTSPLTSSVATGTNLVLYAAPLSPLLPLQDGTNTHIMATEAS NYAQYRVARATIRYRPLVPNAVGGYAISISFWPQTTPTPTSVDMNSITSTDVRILVQPGI ASELVIPSERLHYRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLL DFALELEFRNLTPGNTNTRVSRYSSTARHRLRRGADGTAELTTTAATRFMKDLYFTSTNG VGEIGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRPVVSANGEPTVKLYTSVENAQ QDKGIAIPNDIDLGESRVVIQDYDNQHEQDRPTPSPAPSRPFSVLRANDVLWLSLTAAEY DQSTYGSSTGPVYVSDSVTLVNVATGAQAVARSLDWTKVTLDGRPLSTIQQYSKIFFVLP LRGKLSFWEAGTTRPGYPYNYNTTASDQLLVENAAGHRVAISTYTTSLGAGPVSISAVAV LGPHSALALLEDTLDYPARAHTFDDFCPECRPLGLQGCAFQSTVAELQRLKMKVGKTREL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 7,633  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q68985CAPSD_HEVHYSecreted protein ORF2Hepatitis E virus genotype 1 (isolate Human/India/Hyderabad) (HEV-1)512346UniRef100_Q68985
UniRef90_Q68985
660Representative
Q9IVZ8CAPSD_HEVCTCapsid proteinHepatitis E virus genotype 4 (isolate Human/China/T1) (HEV-4) (Hepatitis E virus genotype 4 (isolate Human/China/Ct1))509627UniRef100_Q9IVZ8
UniRef90_Q68985
672
Q81871CAPSD_HEVCHSecreted protein ORF2Hepatitis E virus genotype 1 (isolate Human/China/HeBei/1987) (HEV)652674UniRef100_Q81871
UniRef90_Q68985
660
Q9YLQ9CAPSD_HEVUSCapsid proteinHepatitis E virus genotype 3 (isolate Human/United States/US2) (HEV-3)509615UniRef100_Q9YLQ9
UniRef90_Q68985
660
Q04611CAPSD_HEVMYSecreted protein ORF2Hepatitis E virus genotype 1 (isolate Human/Myanmar/HEVNE8L) (HEV-1)31769UniRef100_Q04611
UniRef90_Q68985
660
Q00270CAPSD_HEVRHCapsid protein (Fragment)Hepatitis E virus (isolate Rhesus/HT-4) (HEV)31766UniRef100_Q04611
UniRef90_Q68985
485
Q6J8F7CAPSD_HEVMGCapsid proteinHepatitis E virus genotype 3 (isolate Swine/United States/swUS1) (HEV-3) (Hepatitis E virus genotype 3 (isolate Swine/United States/Meng))512345UniRef100_Q6J8F7
UniRef90_Q68985
660
P29326CAPSD_HEVBUSecreted protein ORF2Hepatitis E virus genotype 1 (isolate Human/Burma) (HEV-1)31767UniRef100_P29326
UniRef90_Q68985
660
P33426CAPSD_HEVPASecreted protein ORF2Hepatitis E virus genotype 1 (isolate Human/Pakistan/Sar-55) (HEV-1)33774UniRef100_P33426
UniRef90_Q68985
660
Q03500CAPSD_HEVMECapsid proteinHepatitis E virus genotype 2 (isolate Human/Mexico) (HEV-2)31768UniRef100_Q03500
UniRef90_Q03500
659
Q68985-2Isoform 2 of CAPSD_HEVHYCapsid protein ORF2Hepatitis E virus genotype 1 (isolate Human/India/Hyderabad) (HEV-1)512346UniRef100_Q68985
UniRef90_Q68985
645
E2I988E2I988_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
126
E2I995E2I995_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
126
E2I991E2I991_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
126
E2I9B7E2I9B7_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
126
A0A097PUR1A0A097PUR1_HEVCapsid protein (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
72
A0A097PUQ3A0A097PUQ3_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
115
A0A097PUN0A0A097PUN0_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
93
E2IY72E2IY72_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
87
A0A0P0CBI9A0A0P0CBI9_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
156
E2I994E2I994_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
130
A0A097PUM6A0A097PUM6_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
72
Q764U9Q764U9_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
137
Q764W2Q764W2_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
137
A0A0F7RLS7A0A0F7RLS7_HEVProtein ORF2 (Fragment)Hepatitis E virus (HEV)12461UniRef100_Q68985
UniRef90_Q68985
137

Sequence

Representative sequenceiLengthMass (Da)Tools
Q68985

Checksumi: 948556F804382EB3

FASTA66070,937
        10         20         30         40         50
MGPRPILLLF LMFLPMLLAP PPGQPSGRRR GRRSGGSGGG FWGDRVDSQP
60 70 80 90 100
FAIPYIHPTN PFAPNVTAAA GAGPRVRQPV RPLGSAWRDQ AQRPAAASRR
110 120 130 140 150
RPTTAGAAPL TAVAPAHDTP PVPDVDSRGA ILRRQYNLST SPLTSSVATG
160 170 180 190 200
TNLVLYAAPL SPLLPLQDGT NTHIMATEAS NYAQYRVARA TIRYRPLVPN
210 220 230 240 250
AVGGYAISIS FWPQTTPTPT SVDMNSITST DVRILVQPGI ASELVIPSER
260 270 280 290 300
LHYRNQGWRS VETSGVAEEE ATSGLVMLCI HGSPVNSYTN TPYTGALGLL
310 320 330 340 350
DFALELEFRN LTPGNTNTRV SRYSSTARHR LRRGADGTAE LTTTAATRFM
360 370 380 390 400
KDLYFTSTNG VGEIGRGIAL TLFNLADTLL GGLPTELISS AGGQLFYSRP
410 420 430 440 450
VVSANGEPTV KLYTSVENAQ QDKGIAIPND IDLGESRVVI QDYDNQHEQD
460 470 480 490 500
RPTPSPAPSR PFSVLRANDV LWLSLTAAEY DQSTYGSSTG PVYVSDSVTL
510 520 530 540 550
VNVATGAQAV ARSLDWTKVT LDGRPLSTIQ QYSKIFFVLP LRGKLSFWEA
560 570 580 590 600
GTTRPGYPYN YNTTASDQLL VENAAGHRVA ISTYTTSLGA GPVSISAVAV
610 620 630 640 650
LGPHSALALL EDTLDYPARA HTFDDFCPEC RPLGLQGCAF QSTVAELQRL
660
KMKVGKTREL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again