Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q6AZW8 Zinc finger protein 660 n=108 Tax=Eutheria TaxID=9347 RepID=ZN660_HUMAN MRRKTRNFKHKTVKDNKVLTEGSDQESEKDNSQCCDPATNERVQAEKRQYVCTECGKAFS QSANLTVHERIHTGEKPYKCKECGKAFSHSSNLVVHRRIHTGLKPYTCSECGKSFSGKSH LIRHQGIHSGEKTYECKECGKAFSRSSGLISHHRVHTGEKPYSCIECGKAFSRSSNLTQH QRMHRGKKVYKCKECGKTCGSNTKIMDHQRIHTGEKPYECDECGKTFILRKTLNEHQRLH RREKPYKCNECGKAFTSNRNLVDHQRVHTGEKPYKCNECGKTFRQTSQVILHLRTHTKEK PYKCSECGKAYRYSSQLIQHQRKHNEEKETS

Members

List component clusters with 100% or 90% identity.
1 to 25 of 108  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q6AZW8ZN660_HUMANZinc finger protein 660Homo sapiens (Human)9606UniRef100_Q6AZW8
UniRef90_Q6AZW8
331Representative
C9J3N9C9J3N9_HUMANZinc finger protein 660 (Fragment)Homo sapiens (Human)9606UniRef100_Q6AZW8
UniRef90_Q6AZW8
39
C9J3D4C9J3D4_HUMANZinc finger protein 660 (Fragment)Homo sapiens (Human)9606UniRef100_Q6AZW8
UniRef90_Q6AZW8
34
A0A2J8WXL8A0A2J8WXL8_PONABZNF660 isoform 3 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q6AZW8
UniRef90_Q6AZW8
34
A0A286Y1N6A0A286Y1N6_CAVPOUncharacterized proteinCavia porcellus (Guinea pig)10141UniRef100_A0A286Y1N6
UniRef90_Q6AZW8
335
A0A3Q7RPD5A0A3Q7RPD5_VULVUzinc finger protein 660Vulpes vulpes (Red fox)9627UniRef100_A0A3Q7RPD5
UniRef90_Q6AZW8
333
A0A2R8MLZ6A0A2R8MLZ6_CALJAZinc finger protein 660Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_A0A2R8MLZ6
UniRef90_Q6AZW8
332
A0A2K5C074A0A2K5C074_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5C074
UniRef90_Q6AZW8
332
A0A2K6EQE0A0A2K6EQE0_PROCOUncharacterized proteinPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)379532UniRef100_A0A2K6EQE0
UniRef90_Q6AZW8
331
G7MIW2G7MIW2_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_G7MIW2
UniRef90_Q6AZW8
331
A0A0D9SBE6A0A0D9SBE6_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_G7MIW2
UniRef90_Q6AZW8
331
G8F2T7G8F2T7_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7MIW2
UniRef90_Q6AZW8
331
A0A2J8WXI5A0A2J8WXI5_PONABZNF660 isoform 2 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_G7MIW2
UniRef90_Q6AZW8
39
H9F047H9F047_MACMUZinc finger protein 660 (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_G7MIW2
UniRef90_Q6AZW8
252
A0A2I3LKH5A0A2I3LKH5_PAPANUncharacterized proteinPapio anubis (Olive baboon)9555UniRef100_A0A2I3LKH5
UniRef90_Q6AZW8
331
A0A2K5KYU7A0A2K5KYU7_CERATZinc finger protein 660Cercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2I3LKH5
UniRef90_Q6AZW8
331
A0A2K5HCQ5A0A2K5HCQ5_COLAPUncharacterized proteinColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5HCQ5
UniRef90_Q6AZW8
331
A0A5E4CPK2A0A5E4CPK2_MARMOUncharacterized proteinMarmota monax (Woodchuck)9995UniRef100_A0A5E4CPK2
UniRef90_Q6AZW8
331
L5KFM6L5KFM6_PTEALZinc finger protein 660Pteropus alecto (Black flying fox)9402UniRef100_L5KFM6
UniRef90_Q6AZW8
331
G1U9M6G1U9M6_RABITUncharacterized proteinOryctolagus cuniculus (Rabbit)9986UniRef100_G1U9M6
UniRef90_Q6AZW8
331
A0A2K5XAW8A0A2K5XAW8_MANLEUncharacterized proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K5XAW8
UniRef90_Q6AZW8
331
A0A2K6NA74A0A2K6NA74_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6NA74
UniRef90_Q6AZW8
331
A0A2K6KQB8A0A2K6KQB8_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6NA74
UniRef90_Q6AZW8
331
H0WUV0H0WUV0_OTOGAUncharacterized proteinOtolemur garnettii (Small-eared galago) (Garnett's greater bushbaby)30611UniRef100_H0WUV0
UniRef90_Q6AZW8
331
A0A2J8PAQ3A0A2J8PAQ3_PANTRZNF660 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8PAQ3
UniRef90_Q6AZW8
331

Sequence

Representative sequenceiLengthMass (Da)Tools
Q6AZW8

Checksumi: 0F78D1090AA32CB4

FASTA33138,270
        10         20         30         40         50
MRRKTRNFKH KTVKDNKVLT EGSDQESEKD NSQCCDPATN ERVQAEKRQY
60 70 80 90 100
VCTECGKAFS QSANLTVHER IHTGEKPYKC KECGKAFSHS SNLVVHRRIH
110 120 130 140 150
TGLKPYTCSE CGKSFSGKSH LIRHQGIHSG EKTYECKECG KAFSRSSGLI
160 170 180 190 200
SHHRVHTGEK PYSCIECGKA FSRSSNLTQH QRMHRGKKVY KCKECGKTCG
210 220 230 240 250
SNTKIMDHQR IHTGEKPYEC DECGKTFILR KTLNEHQRLH RREKPYKCNE
260 270 280 290 300
CGKAFTSNRN LVDHQRVHTG EKPYKCNECG KTFRQTSQVI LHLRTHTKEK
310 320 330
PYKCSECGKA YRYSSQLIQH QRKHNEEKET S
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again