Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q6IA69 Glutamine-dependent NAD(+) synthetase n=44 Tax=Bilateria TaxID=33213 RepID=NADE_HUMAN MGRKVTVATCALNQWALDFEGNLQRILKSIEIAKNRGARYRLGPELEICGYGCWDHYYES DTLLHSFQVLAALVESPVTQDIICDVGMPVMHRNVRYNCRVIFLNRKILLIRPKMALANE GNYRELRWFTPWSRSRHTEEYFLPRMIQDLTKQETVPFGDAVLVTWDTCIGSEICEELWT PHSPHIDMGLDGVEIITNASGSHQVLRKANTRVDLVTMVTSKNGGIYLLANQKGCDGDRL YYDGCAMIAMNGSVFAQGSQFSLDDVEVLTATLDLEDVRSYRAEISSRNLAASRASPYPR VKVDFALSCHEDLLAPISEPIEWKYHSPEEEISLGPACWLWDFLRRSQQAGFLLPLSGGV DSAATACLIYSMCCQVCEAVRSGNEEVLADVRTIVNQISYTPQDPRDLCGRILTTCYMAS KNSSQETCTRARELAQQIGSHHISLNIDPAVKAVMGIFSLVTGKSPLFAAHGGSSRENLA LQNVQARIRMVLAYLFAQLSLWSRGVHGGLLVLGSANVDESLLGYLTKYDCSSADINPIG GISKTDLRAFVQFCIQRFQLPALQSILLAPATAELEPLADGQVSQTDEEDMGMTYAELSV YGKLRKVAKMGPYSMFCKLLGMWRHICTPRQVADKVKRFFSKYSMNRHKMTTLTPAYHAE NYSPEDNRFDLRPFLYNTSWPWQFRCIENQVLQLERAEPQSLDGVD

Members

List component clusters with 100% or 90% identity.
1 to 25 of 44  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q6IA69NADE_HUMANGlutamine-dependent NAD(+) synthetaseHomo sapiens (Human)9606UniRef100_Q6IA69
UniRef90_Q6IA69
706Representative
A0A0B4J216A0A0B4J216_HUMANGlutamine-dependent NAD(+) synthetaseHomo sapiens (Human)9606UniRef100_Q6IA69
UniRef90_Q6IA69
335
E9PND0E9PND0_HUMANGlutamine-dependent NAD(+) synthetaseHomo sapiens (Human)9606UniRef100_Q6IA69
UniRef90_Q6IA69
88
A0A2J8S694A0A2J8S694_PONABNADSYN1 isoform 21 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q6IA69
UniRef90_Q6IA69
110
A0A2J8IQ74A0A2J8IQ74_PANTRNADSYN1 isoform 3 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_Q6IA69
UniRef90_Q6IA69
110
F7BY91F7BY91_HORSENAD synthetase 1Equus caballus (Horse)9796UniRef100_F7BY91
UniRef90_Q6IA69
828
A0A3Q7VL87A0A3Q7VL87_URSARGlutamine-dependent NAD(+) synthetaseUrsus arctos horribilis116960UniRef100_A0A3Q7VL87
UniRef90_Q6IA69
720
A0A2Y9F545A0A2Y9F545_PHYMCGlutamine-dependent NAD(+) synthetasePhyseter macrocephalus (Sperm whale) (Physeter catodon)9755UniRef100_A0A2Y9F545
UniRef90_Q6IA69
712
A0A2K5IY44A0A2K5IY44_COLAPGlutamine-dependent NAD(+) synthetaseColobus angolensis palliatus (Peters' Angolan colobus)336983UniRef100_A0A2K5IY44
UniRef90_Q6IA69
706
M3W1L6M3W1L6_FELCAGlutamine-dependent NAD(+) synthetaseFelis catus (Cat) (Felis silvestris catus)9685UniRef100_M3W1L6
UniRef90_Q6IA69
706
A0A096MPW7A0A096MPW7_PAPANGlutamine-dependent NAD(+) synthetasePapio anubis (Olive baboon)9555UniRef100_A0A096MPW7
UniRef90_Q6IA69
706
A0A485N727A0A485N727_LYNPAGlutamine-dependent NAD(+) synthetaseLynx pardinus (Iberian lynx) (Felis pardina)191816UniRef100_A0A485N727
UniRef90_Q6IA69
706
A0A485N4A0A0A485N4A0_LYNPAGlutamine-dependent NAD(+) synthetaseLynx pardinus (Iberian lynx) (Felis pardina)191816UniRef100_A0A485N727
UniRef90_Q6IA69
619
F7B8T2F7B8T2_MACMUGlutamine-dependent NAD(+) synthetaseMacaca mulatta (Rhesus macaque)9544UniRef100_F7B8T2
UniRef90_Q6IA69
706
A0A2K5WZJ4A0A2K5WZJ4_MACFAGlutamine-dependent NAD(+) synthetaseMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_F7B8T2
UniRef90_Q6IA69
706
G3RX01G3RX01_GORGOGlutamine-dependent NAD(+) synthetaseGorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3RX01
UniRef90_Q6IA69
706
K7BU87K7BU87_PANTRGlutamine-dependent NAD(+) synthetasePan troglodytes (Chimpanzee)9598UniRef100_K7BU87
UniRef90_Q6IA69
706
A0A2J8IQ76A0A2J8IQ76_PANTRNADSYN1 isoform 7Pan troglodytes (Chimpanzee)9598UniRef100_K7BU87
UniRef90_Q6IA69
335
A0A2R8Z6M8A0A2R8Z6M8_PANPAGlutamine-dependent NAD(+) synthetasePan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_K7BU87
UniRef90_Q6IA69
618
A0A2J8IQ60A0A2J8IQ60_PANTRNADSYN1 isoform 1 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_K7BU87
UniRef90_Q6IA69
438
H9EWR4H9EWR4_MACMUGlutamine-dependent NAD(+) synthetaseMacaca mulatta (Rhesus macaque)9544UniRef100_H9EWR4
UniRef90_Q6IA69
706
A0A2K5LJ70A0A2K5LJ70_CERATGlutamine-dependent NAD(+) synthetaseCercocebus atys (Sooty mangabey) (Cercocebus torquatus atys)9531UniRef100_A0A2K5LJ70
UniRef90_Q6IA69
706
L9LDX0L9LDX0_TUPCHGlutamine-dependent NAD(+) synthetaseTupaia chinensis (Chinese tree shrew)246437UniRef100_L9LDX0
UniRef90_Q6IA69
705
A0A2K6ALB6A0A2K6ALB6_MANLENAD_synthase domain-containing proteinMandrillus leucophaeus (Drill) (Papio leucophaeus)9568UniRef100_A0A2K6ALB6
UniRef90_Q6IA69
335
A0A0B6ZQ45A0A0B6ZQ45_9EUPUCN hydrolase domain-containing proteinArion vulgaris1028688UniRef100_A0A0B6ZQ45
UniRef90_A0A0B6ZQ45
840

Sequence

Representative sequenceiLengthMass (Da)Tools
Q6IA69

Checksumi: 9788B060F3A1D13B

FASTA70679,285
        10         20         30         40         50
MGRKVTVATC ALNQWALDFE GNLQRILKSI EIAKNRGARY RLGPELEICG
60 70 80 90 100
YGCWDHYYES DTLLHSFQVL AALVESPVTQ DIICDVGMPV MHRNVRYNCR
110 120 130 140 150
VIFLNRKILL IRPKMALANE GNYRELRWFT PWSRSRHTEE YFLPRMIQDL
160 170 180 190 200
TKQETVPFGD AVLVTWDTCI GSEICEELWT PHSPHIDMGL DGVEIITNAS
210 220 230 240 250
GSHQVLRKAN TRVDLVTMVT SKNGGIYLLA NQKGCDGDRL YYDGCAMIAM
260 270 280 290 300
NGSVFAQGSQ FSLDDVEVLT ATLDLEDVRS YRAEISSRNL AASRASPYPR
310 320 330 340 350
VKVDFALSCH EDLLAPISEP IEWKYHSPEE EISLGPACWL WDFLRRSQQA
360 370 380 390 400
GFLLPLSGGV DSAATACLIY SMCCQVCEAV RSGNEEVLAD VRTIVNQISY
410 420 430 440 450
TPQDPRDLCG RILTTCYMAS KNSSQETCTR ARELAQQIGS HHISLNIDPA
460 470 480 490 500
VKAVMGIFSL VTGKSPLFAA HGGSSRENLA LQNVQARIRM VLAYLFAQLS
510 520 530 540 550
LWSRGVHGGL LVLGSANVDE SLLGYLTKYD CSSADINPIG GISKTDLRAF
560 570 580 590 600
VQFCIQRFQL PALQSILLAP ATAELEPLAD GQVSQTDEED MGMTYAELSV
610 620 630 640 650
YGKLRKVAKM GPYSMFCKLL GMWRHICTPR QVADKVKRFF SKYSMNRHKM
660 670 680 690 700
TTLTPAYHAE NYSPEDNRFD LRPFLYNTSW PWQFRCIENQ VLQLERAEPQ

SLDGVD
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again