Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q6N4R5 50S ribosomal protein L1 n=2823 RepID=RL1_RHOPA MAIGKRLKKIREGIDRTKLYPLDEAVKLVKERAISKFDETIEVAINLGVDPRHADQMVRG VVMLPNGTGRTVRVGVFARGAKADEAKAAGADVVGAEDLVEQVQAGNINFDRCIATPDMM PLVGRLGKVLGPRGMMPNPKIGTVTMDVAGAVKGAKGGSVEFRVEKAGIIQAGVGKASFD ADKLVENIKALADAVNKAKPSGAKGTYIQRVAVSSTMGPGVKVEPGTVH

Members

List component clusters with 100% or 90% identity.
1 to 25 of 2,823  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q6N4R5RL1_RHOPA50S ribosomal protein L1Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)258594UniRef100_Q6N4R5
UniRef90_Q6N4R5
229Representative
Q3SSY3RL1_NITWN50S ribosomal protein L1Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)323098UniRef100_Q3SSY3
UniRef90_Q6N4R5
230
Q211C5RL1_RHOPB50S ribosomal protein L1Rhodopseudomonas palustris (strain BisB18)316056UniRef100_Q211C5
UniRef90_Q6N4R5
230
Q1QN47RL1_NITHX50S ribosomal protein L1Nitrobacter hamburgensis (strain DSM 10229 / NCIMB 13809 / X14)323097UniRef100_Q1QN47
UniRef90_Q6N4R5
230
A5ELP1RL1_BRASB50S ribosomal protein L1Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)288000UniRef100_A5ELP1
UniRef90_Q6N4R5
230
Q2IXS7RL1_RHOP250S ribosomal protein L1Rhodopseudomonas palustris (strain HaA2)316058UniRef100_Q2IXS7
UniRef90_Q6N4R5
229
B3QC04RL1_RHOPT50S ribosomal protein L1Rhodopseudomonas palustris (strain TIE-1)395960UniRef100_B3QC04
UniRef90_Q6N4R5
229
Q2GA44RL1_NOVAD50S ribosomal protein L1Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CIP 105152 / NBRC 16084 / F199)279238UniRef100_Q2GA44
UniRef90_Q2GA44
233
Q0BYA1RL1_HYPNA50S ribosomal protein L1Hyphomonas neptunium (strain ATCC 15444)228405UniRef100_Q0BYA1
UniRef90_Q0BYA1
231
B2IK52RL1_BEII950S ribosomal protein L1Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712)395963UniRef100_B2IK52
UniRef90_B2IK52
231
B1LY47RL1_METRJ50S ribosomal protein L1Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)426355UniRef100_B1LY47
UniRef90_B1LY47
232
A5V9F6RL1_SPHWW50S ribosomal protein L1Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273)392499UniRef100_A5V9F6
UniRef90_A5V9F6
232
B7KN27RL1_METC450S ribosomal protein L1Methylorubrum extorquens (strain CM4 / NCIMB 13688) (Methylobacterium extorquens)440085UniRef100_B7KN27
UniRef90_B1ZFX0
232
A9W8M1RL1_METEP50S ribosomal protein L1Methylorubrum extorquens (strain PA1) (Methylobacterium extorquens)419610UniRef100_B7KN27
UniRef90_B1ZFX0
232
B1ZFX0RL1_METPB50S ribosomal protein L1Methylorubrum populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) (Methylobacterium populi)441620UniRef100_B1ZFX0
UniRef90_B1ZFX0
232
Q2NDY5RL1_ERYLH50S ribosomal protein L1Erythrobacter litoralis (strain HTCC2594)314225UniRef100_Q2NDY5
UniRef90_Q2NDY5
230
B0T064RL1_CAUSK50S ribosomal protein L1Caulobacter sp. (strain K31)366602UniRef100_B0T064
UniRef90_B0T064
229
A5FZX4RL1_ACICJ50S ribosomal protein L1Acidiphilium cryptum (strain JF-5)349163UniRef100_A5FZX4
UniRef90_A5FZX4
230
A7HWQ1RL1_PARL150S ribosomal protein L1Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966)402881UniRef100_A7HWQ1
UniRef90_A7HWQ1
233
A1USC5RL1_BARBK50S ribosomal protein L1Bartonella bacilliformis (strain ATCC 35685 / NCTC 12138 / KC583)360095UniRef100_A1USC5
UniRef90_A1USC5
232
Q160X4RL1_ROSDO50S ribosomal protein L1Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans)375451UniRef100_Q160X4
UniRef90_Q160X4
232
B8IS73RL1_METNO50S ribosomal protein L1Methylobacterium nodulans (strain LMG 21967 / CNCM I-2342 / ORS 2060)460265UniRef100_B8IS73
UniRef90_B8IS73
235
B0UHY1RL1_METS450S ribosomal protein L1Methylobacterium sp. (strain 4-46)426117UniRef100_B0UHY1
UniRef90_B8IS73
235
Q5FTX4RL1_GLUOX50S ribosomal protein L1Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans)290633UniRef100_Q5FTX4
UniRef90_Q5FTX4
230
Q9AAG0RL1_CAUVC50S ribosomal protein L1Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)190650UniRef100_Q9AAG0
UniRef90_Q9AAG0
229

Sequence

Representative sequenceiLengthMass (Da)Tools
Q6N4R5

Checksumi: C9867D87DF367722

FASTA22924,010
        10         20         30         40         50
MAIGKRLKKI REGIDRTKLY PLDEAVKLVK ERAISKFDET IEVAINLGVD
60 70 80 90 100
PRHADQMVRG VVMLPNGTGR TVRVGVFARG AKADEAKAAG ADVVGAEDLV
110 120 130 140 150
EQVQAGNINF DRCIATPDMM PLVGRLGKVL GPRGMMPNPK IGTVTMDVAG
160 170 180 190 200
AVKGAKGGSV EFRVEKAGII QAGVGKASFD ADKLVENIKA LADAVNKAKP
210 220
SGAKGTYIQR VAVSSTMGPG VKVEPGTVH
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again