Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q6PGA0-2 Isoform 2 of REST corepressor 3 n=162 Tax=Euteleostomi TaxID=117571 RepID=Isoform 2 of RCOR3_MOUSE MPGMMEKGPELLGKSRSANGGAKSPAGGGGSSANGGLHFSEPESGCSSDDEHGDVGMRVG AEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPDAKLDEYIAIAKEKHGYNVEQALGM LFWHKHNIEKSLADLPNFTPFPDEWTVEDKVLFEQAFSFHGKSFHRIQQMLPDKTIASLV KYYYSWKKTRSRTSLMDRQARKLANRHNQGDSDDDVEEAHPMDGNDSDYDPKKEAKREGN ADQPVQTSKIGLGRREYQSLQHRHHSQRSKCRPPKGMYLTQEDVVAVSCSPNAANTILRQ LDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPESNQKINARWTTEEQLLAVQGTDP TGSSDSGSITSCPIIHSNTNSPHCHSEPASTTSSSNTACRPCSSPTTSSTPAAGSVHPAP ANSQSASSTSHSPC

Members

List component clusters with 100% or 90% identity.
1 to 25 of 162  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q6PGA0-2Isoform 2 of RCOR3_MOUSE2Mus musculus (Mouse)10090UniRef100_Q6PGA0-2
UniRef90_Q6PGA0-2
434Representative
A0A5E4CP73A0A5E4CP73_MARMOUncharacterized proteinMarmota monax (Woodchuck)9995UniRef100_A0A5E4CP73
UniRef90_Q6PGA0-2
436
A0A5E4CP89A0A5E4CP89_MARMOUncharacterized proteinMarmota monax (Woodchuck)9995UniRef100_A0A5E4CP89
UniRef90_Q6PGA0-2
435
A0A287CZX2A0A287CZX2_ICTTRUncharacterized proteinIctidomys tridecemlineatus (Thirteen-lined ground squirrel) (Spermophilus tridecemlineatus)43179UniRef100_A0A287CZX2
UniRef90_Q6PGA0-2
380
A0A2Y9GKL5A0A2Y9GKL5_NEOSCREST corepressor 3Neomonachus schauinslandi (Hawaiian monk seal) (Monachus schauinslandi)29088UniRef100_A0A2Y9GKL5
UniRef90_A0A2Y9GKL5
467
A0A2U3V6C8A0A2U3V6C8_TURTRREST corepressor 3Tursiops truncatus (Atlantic bottle-nosed dolphin) (Delphinus truncatus)9739UniRef100_A0A2U3V6C8
UniRef90_A0A2I3RXD1
484
A0A1U7QNR4A0A1U7QNR4_MESAUREST corepressor 3 isoform X6Mesocricetus auratus (Golden hamster)10036UniRef100_A0A1U7QNR4
UniRef90_A0A2I3RXD1
395
A0A2K5D364A0A2K5D364_AOTNAUncharacterized proteinAotus nancymaae (Ma's night monkey)37293UniRef100_A0A2K5D364
UniRef90_A0A2I3RXD1
391
A0A2R9B330A0A2R9B330_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R9B330
UniRef90_A0A2I3RXD1
391
A0A2I3RXD1A0A2I3RXD1_PANTRREST corepressor 3Pan troglodytes (Chimpanzee)9598UniRef100_A0A2I3RXD1
UniRef90_A0A2I3RXD1
390
A0A2I2Z1C3A0A2I2Z1C3_GORGOREST corepressor 3Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_A0A2I2Z1C3
UniRef90_A0A2I3RXD1
389
A0A2K6QYD8A0A2K6QYD8_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6QYD8
UniRef90_A0A2K6QYD8
396
A0A2K6JTJ3A0A2K6JTJ3_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6QYD8
UniRef90_A0A2K6QYD8
396
A0A2I3GAA8A0A2I3GAA8_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_A0A2I3GAA8
UniRef90_A0A2I3GAA8
395
A0A287AN87A0A287AN87_PIGUncharacterized proteinSus scrofa (Pig)9823UniRef100_A0A287AN87
UniRef90_A0A287AN87
364
A0A151MZW5A0A151MZW5_ALLMIREST corepressor 2Alligator mississippiensis (American alligator)8496UniRef100_A0A151MZW5
UniRef90_A0A151MZW5
424
A0A452EUG1A0A452EUG1_CAPHIUncharacterized proteinCapra hircus (Goat)9925UniRef100_A0A452EUG1
UniRef90_A0A452EUG1
455
A0A3Q2EEG1A0A3Q2EEG1_CYPVAUncharacterized proteinCyprinodon variegatus (Sheepshead minnow)28743UniRef100_A0A3Q2EEG1
UniRef90_A0A3Q2EEG1
492
A0A4X2KUA8A0A4X2KUA8_VOMURUncharacterized proteinVombatus ursinus (Common wombat)29139UniRef100_A0A4X2KUA8
UniRef90_A0A4X2KUA8
435
H3B6Y4H3B6Y4_LATCHUncharacterized proteinLatimeria chalumnae (Coelacanth)7897UniRef100_H3B6Y4
UniRef90_H3B6Y4
452
A0A480QCY4A0A480QCY4_PIGREST corepressor 3 isoform cSus scrofa (Pig)9823UniRef100_A0A480QCY4
UniRef90_K7BWM0
449
H9FX17H9FX17_MACMUREST corepressor 3 isoform cMacaca mulatta (Rhesus macaque)9544UniRef100_H9FX17
UniRef90_K7BWM0
449
U3DMR9U3DMR9_CALJAREST corepressor 3 isoform cCallithrix jacchus (White-tufted-ear marmoset)9483UniRef100_U3DMR9
UniRef90_K7BWM0
449
K7BWM0K7BWM0_PANTRRCOR3 isoform 9Pan troglodytes (Chimpanzee)9598UniRef100_K7BWM0
UniRef90_K7BWM0
449
A0A2J8V6G3A0A2J8V6G3_PONABRCOR3 isoform 8Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_K7BWM0
UniRef90_K7BWM0
449

Sequence

Representative sequenceiLengthMass (Da)Tools
Q6PGA0-2

Checksumi: 2BEDF63F73A3829F

FASTA43447,471
        10         20         30         40         50
MPGMMEKGPE LLGKSRSANG GAKSPAGGGG SSANGGLHFS EPESGCSSDD
60 70 80 90 100
EHGDVGMRVG AEYQARIPEF DPGATKYTDK DNGGMLVWSP YHSIPDAKLD
110 120 130 140 150
EYIAIAKEKH GYNVEQALGM LFWHKHNIEK SLADLPNFTP FPDEWTVEDK
160 170 180 190 200
VLFEQAFSFH GKSFHRIQQM LPDKTIASLV KYYYSWKKTR SRTSLMDRQA
210 220 230 240 250
RKLANRHNQG DSDDDVEEAH PMDGNDSDYD PKKEAKREGN ADQPVQTSKI
260 270 280 290 300
GLGRREYQSL QHRHHSQRSK CRPPKGMYLT QEDVVAVSCS PNAANTILRQ
310 320 330 340 350
LDMELISLKR QVQNAKQVNS ALKQKMEGGI EEFKPPESNQ KINARWTTEE
360 370 380 390 400
QLLAVQGTDP TGSSDSGSIT SCPIIHSNTN SPHCHSEPAS TTSSSNTACR
410 420 430
PCSSPTTSST PAAGSVHPAP ANSQSASSTS HSPC
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again