Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
>UniRef50_Q6ZW61 Bardet-Biedl syndrome 12 protein n=180 Tax=Mammalia TaxID=40674 RepID=BBS12_HUMAN MVMACRVVNKRRHMGLQQLSSFAETGRTFLGPLKSSKFIIDEECHESVLISSTVRLLESL DLTSAVGQLLNEAVQAQNNTYRTGISTLLFLVGAWSSAVEECLHLGVPISIIVSVMSEGL NFCSEEVVSLHVPVHNIFDCMDSTKTFSQLETFSVSLCPFLQVPSDTDLIEELHGLKDVA SQTLTISNLSGRPLKSYELFKPQTKVEADNNTSRTLKNSLLADTCCRQSILIHSRHFNRT DNTEGVSKPDGFQEHVTATHKTYRCNDLVELAVGLSHGDHSSMKLVEEAVQLQYQNACVQ QGNCTKPFMFDISRIFTCCLPGLPETSSCVCPGYITVVSVSNNPVIKELQNQPVRIVLIE GDLTENYRHLGFNKSANIKTVLDSMRLQEDSSEELWANHVLQVLIQFKVNLVLVQGNVSE RLIEKCINSKRLVIGSVNGSVMQAFAEAAGAVQVAYITQVNEDCVGDGVCVTFWRSSPLD VVDRNNRIAILLKTEGINLVTAVLTNPVTAQMQIKEDRFWTCAYRLYYALKEEKVFLGGG AVEFLCLSCLHILAEQSLKKENHACSGWLHNTSSWLASSLAIYRPTVLKFLANGWQKYLS TLLYNTANYSSEFEASTYIQHHLQNATDSGSPSSYILNEYSKLNSRIFNSDISNKLEQIP RVYDVVTPKIEAWRRALDLVLLVLQTDSEIITGHGHTQINSQELTGFLFL

Members

List component clusters with 100% or 90% identity.
1 to 25 of 180  Show
Cluster membersEntry nameProtein names
Organisms
Organism IDsRelated clustersLength
Role
Q6ZW61BBS12_HUMANBardet-Biedl syndrome 12 proteinHomo sapiens (Human)9606UniRef100_Q6ZW61
UniRef90_Q6ZW61
710Representative
Q5RC62BBS12_PONABBardet-Biedl syndrome 12 protein homologPongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_Q5RC62
UniRef90_Q6ZW61
710
Q5SUD9BBS12_MOUSEBardet-Biedl syndrome 12 protein homologMus musculus (Mouse)10090UniRef100_Q5SUD9
UniRef90_Q5SUD9
708
A0A1B1SMW0A0A1B1SMW0_HUMANTruncated Bardet-Biedl syndrome 12 proteinHomo sapiens (Human)9606UniRef100_Q6ZW61
UniRef90_Q6ZW61
442
C9J8H7C9J8H7_HUMANBardet-Biedl syndrome 12 protein (Fragment)Homo sapiens (Human)9606UniRef100_Q6ZW61
UniRef90_Q6ZW61
191
F7H903F7H903_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_F7H903
UniRef90_Q6ZW61
710
A0A2K6NDC0A0A2K6NDC0_RHIROUncharacterized proteinRhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana)61622UniRef100_A0A2K6NDC0
UniRef90_Q6ZW61
710
A0A2R8ZNB5A0A2R8ZNB5_PANPAUncharacterized proteinPan paniscus (Pygmy chimpanzee) (Bonobo)9597UniRef100_A0A2R8ZNB5
UniRef90_Q6ZW61
710
F7C208F7C208_CALJABardet-Biedl syndrome 12Callithrix jacchus (White-tufted-ear marmoset)9483UniRef100_F7C208
UniRef90_Q6ZW61
710
A0A2K6KQJ0A0A2K6KQJ0_RHIBEUncharacterized proteinRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)61621UniRef100_A0A2K6KQJ0
UniRef90_Q6ZW61
710
G2HFU5G2HFU5_PANTRUncharacterized proteinPan troglodytes (Chimpanzee)9598UniRef100_G2HFU5
UniRef90_Q6ZW61
710
K7BU58K7BU58_PANTRBardet-Biedl syndrome 12Pan troglodytes (Chimpanzee)9598UniRef100_K7BU58
UniRef90_Q6ZW61
710
A0A2J8LXB3A0A2J8LXB3_PANTRBBS12 isoform 1Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LXB3
UniRef90_Q6ZW61
710
A0A2J8LXD9A0A2J8LXD9_PANTRBBS12 isoform 3 (Fragment)Pan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LXB3
UniRef90_Q6ZW61
191
G2HIL4G2HIL4_PANTRUncharacterized proteinPan troglodytes (Chimpanzee)9598UniRef100_A0A2J8LXB3
UniRef90_Q6ZW61
428
H2QQ46H2QQ46_PANTRBardet-Biedl syndrome 12Pan troglodytes (Chimpanzee)9598UniRef100_H2QQ46
UniRef90_Q6ZW61
710
A0A2J8XPM3A0A2J8XPM3_PONABBBS12 isoform 1Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XPM3
UniRef90_Q6ZW61
710
A0A2J8XPN0A0A2J8XPN0_PONABBBS12 isoform 3 (Fragment)Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)9601UniRef100_A0A2J8XPM3
UniRef90_Q6ZW61
191
G3S2G4G3S2G4_GORGOBardet-Biedl syndrome 12Gorilla gorilla gorilla (Western lowland gorilla)9595UniRef100_G3S2G4
UniRef90_Q6ZW61
710
A0A0D9S9R9A0A0D9S9R9_CHLSBUncharacterized proteinChlorocebus sabaeus (Green monkey) (Cercopithecus sabaeus)60711UniRef100_A0A0D9S9R9
UniRef90_Q6ZW61
710
G7P681G7P681_MACFAUncharacterized proteinMacaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)9541UniRef100_G7P681
UniRef90_Q6ZW61
710
G7MRX6G7MRX6_MACMUUncharacterized proteinMacaca mulatta (Rhesus macaque)9544UniRef100_G7MRX6
UniRef90_Q6ZW61
710
H9FF65H9FF65_MACMUBardet-Biedl syndrome 12 protein (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_G7MRX6
UniRef90_Q6ZW61
87
H9F6J4H9F6J4_MACMUBardet-Biedl syndrome 12 protein (Fragment)Macaca mulatta (Rhesus macaque)9544UniRef100_G7MRX6
UniRef90_Q6ZW61
194
G1S9G6G1S9G6_NOMLEUncharacterized proteinNomascus leucogenys (Northern white-cheeked gibbon) (Hylobates leucogenys)61853UniRef100_G1S9G6
UniRef90_Q6ZW61
710

Sequence

Representative sequenceiLengthMass (Da)Tools
Q6ZW61

Checksumi: F441A12526A23B40

FASTA71079,085
        10         20         30         40         50
MVMACRVVNK RRHMGLQQLS SFAETGRTFL GPLKSSKFII DEECHESVLI
60 70 80 90 100
SSTVRLLESL DLTSAVGQLL NEAVQAQNNT YRTGISTLLF LVGAWSSAVE
110 120 130 140 150
ECLHLGVPIS IIVSVMSEGL NFCSEEVVSL HVPVHNIFDC MDSTKTFSQL
160 170 180 190 200
ETFSVSLCPF LQVPSDTDLI EELHGLKDVA SQTLTISNLS GRPLKSYELF
210 220 230 240 250
KPQTKVEADN NTSRTLKNSL LADTCCRQSI LIHSRHFNRT DNTEGVSKPD
260 270 280 290 300
GFQEHVTATH KTYRCNDLVE LAVGLSHGDH SSMKLVEEAV QLQYQNACVQ
310 320 330 340 350
QGNCTKPFMF DISRIFTCCL PGLPETSSCV CPGYITVVSV SNNPVIKELQ
360 370 380 390 400
NQPVRIVLIE GDLTENYRHL GFNKSANIKT VLDSMRLQED SSEELWANHV
410 420 430 440 450
LQVLIQFKVN LVLVQGNVSE RLIEKCINSK RLVIGSVNGS VMQAFAEAAG
460 470 480 490 500
AVQVAYITQV NEDCVGDGVC VTFWRSSPLD VVDRNNRIAI LLKTEGINLV
510 520 530 540 550
TAVLTNPVTA QMQIKEDRFW TCAYRLYYAL KEEKVFLGGG AVEFLCLSCL
560 570 580 590 600
HILAEQSLKK ENHACSGWLH NTSSWLASSL AIYRPTVLKF LANGWQKYLS
610 620 630 640 650
TLLYNTANYS SEFEASTYIQ HHLQNATDSG SPSSYILNEY SKLNSRIFNS
660 670 680 690 700
DISNKLEQIP RVYDVVTPKI EAWRRALDLV LLVLQTDSEI ITGHGHTQIN
710
SQELTGFLFL
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again